KEGG   Lactobacillus rhamnosus GG: LRHM_2575Help
Entry
LRHM_2575         CDS       T02100                                 

Definition
putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LRHM_2575
Enzymes [BR:lrg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LRHM_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2737892..2738674
Genome map
AA seq 260 aa AA seqDB search
MEMMFQAERTDLAHTVQVMFDRKDTNVAGGNMSIKVFDENEHPYILITPTFMSETYYAEL
HPAQILVVDAITGQKIDGVGDVTREINMHEKAYATHPGIRCVYHSHAEESMFWATAGLDM
PNVTEATRELGRIRVLPFAPATSMALANIVHDALLEIGDKAMENVFLLDSHGIVITSSDL
HIAVRIMETLEWNARIAYQQAIFIKLGLLDDFHSCGGNYKDPYKEVPPIAVPSTPIKSKQ
VPLPSNPTRPVSEMQLGEVE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgatgtttcaggccgaacgtactgatcttgcccatacagtgcaagtgatgttc
gatcgtaaagataccaatgttgctggcggaaatatgtcaattaaagtttttgatgagaat
gagcatccctatatccttatcacacccacttttatgtctgaaacctattacgctgaattg
catcctgcacagatcctagttgttgatgcaatcaccggtcagaaaattgatggtgtcggc
gatgtaacccgagaaattaatatgcatgaaaaggcttacgcaactcatccgggtattcgc
tgtgtttatcattcgcatgctgaagaatctatgttttgggcaactgccggactcgatatg
cccaatgtgaccgaagcaaccagagaactcggacgtataagggttctcccctttgcacca
gcaacttcaatggcattggctaatatcgtacatgatgctctgcttgaaattggtgacaag
gctatggagaatgtctttttacttgatagtcatggtattgtgattacgagttctgacttg
catattgccgttagaatcatggaaacacttgaatggaatgctagaattgcctatcaacaa
gcaattttcattaaattaggcttgcttgacgattttcactcttgtggcggcaattacaaa
gatccttacaaagaggttccgccaattgcggtccctagtactccgattaagtcaaaacaa
gtacctttgccttccaatccaacaagacctgtcagcgaaatgcagttaggtgaagtagag
taa

DBGET integrated database retrieval system