KEGG   Lactobacillus rhamnosus GG: LRHM_2575Help
Entry
LRHM_2575         CDS       T02100                                 

Definition
putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lrg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2737892..2738674
Genome map
AA seq 260 aa AA seqDB search
MEMMFQAERTDLAHTVQVMFDRKDTNVAGGNMSIKVFDENEHPYILITPTFMSETYYAEL
HPAQILVVDAITGQKIDGVGDVTREINMHEKAYATHPGIRCVYHSHAEESMFWATAGLDM
PNVTEATRELGRIRVLPFAPATSMALANIVHDALLEIGDKAMENVFLLDSHGIVITSSDL
HIAVRIMETLEWNARIAYQQAIFIKLGLLDDFHSCGGNYKDPYKEVPPIAVPSTPIKSKQ
VPLPSNPTRPVSEMQLGEVE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgatgtttcaggccgaacgtactgatcttgcccatacagtgcaagtgatgttc
gatcgtaaagataccaatgttgctggcggaaatatgtcaattaaagtttttgatgagaat
gagcatccctatatccttatcacacccacttttatgtctgaaacctattacgctgaattg
catcctgcacagatcctagttgttgatgcaatcaccggtcagaaaattgatggtgtcggc
gatgtaacccgagaaattaatatgcatgaaaaggcttacgcaactcatccgggtattcgc
tgtgtttatcattcgcatgctgaagaatctatgttttgggcaactgccggactcgatatg
cccaatgtgaccgaagcaaccagagaactcggacgtataagggttctcccctttgcacca
gcaacttcaatggcattggctaatatcgtacatgatgctctgcttgaaattggtgacaag
gctatggagaatgtctttttacttgatagtcatggtattgtgattacgagttctgacttg
catattgccgttagaatcatggaaacacttgaatggaatgctagaattgcctatcaacaa
gcaattttcattaaattaggcttgcttgacgattttcactcttgtggcggcaattacaaa
gatccttacaaagaggttccgccaattgcggtccctagtactccgattaagtcaaaacaa
gtacctttgccttccaatccaacaagacctgtcagcgaaatgcagttaggtgaagtagag
taa

DBGET integrated database retrieval system