KEGG   Lactobacillus rhamnosus GG: LGG_00099Help
Entry
LGG_00099         CDS       T00987                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGG_00099 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGG_00099 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGG_00099 (trpB)
Enzymes [BR:lrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LGG_00099 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(103904..105124)
Genome map
AA seq 406 aa AA seqDB search
MKTLNETAQPTNRAGRYGNDFGGQYIPETLMTELEKITAAFNTLKDDPQFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKTRLIAET
GAGQHGVATATIAALMGMECEIFMGKEDTDRQKLNVYRMTLLGAKVHSVTSGSMVLKDAV
NAALQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISIESKQQLQAKEGQLPDMIVAC
VGGGSNAIGSFAAYIDEPSVQLVGVEAAGKGVDTARTAATIERGSVGIFHGMKSLFMQNE
DGQIDPVYSISAGLDYPGVGPEHAALAEAGRAQYVGITDDEAVQAFEYIARQEGIVAAIE
SCHAIAYVEKIAPTMAKDQIIICTLSGRGDKDVASIAKYKGVDVDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactaaatgaaactgctcaacctacaaaccgcgccggccgctatggcaacgac
tttggcggccagtatatcccggaaaccttaatgaccgaactcgaaaaaatcaccgcggct
ttcaacactttaaaagacgacccgcaattcaaagccgaactcaacgatttgttagtcaat
tatgctaatcgaccatcgctactgtattacgccaaaaacatgaccgaagacttaggcggg
gccaagatctatctcaaacgtgaggatctcaatcatactggtgcccataaaatcaacaat
gttatcggacaagccttactcgccaagcatctaggcaaaacccggttaattgccgaaacc
ggcgctggccaacacggtgttgccaccgccacgatcgccgctttgatgggcatggaatgt
gaaattttcatgggaaaagaagatactgaccgccaaaagttaaatgtttatcgcatgaca
ttgctcggcgccaaagtccattctgtcaccagcggctcgatggtgcttaaagacgcggtc
aacgctgcccttcaggaatgggccagtcgcagcgatgacaccttttatgtgctcggttct
gccgtgggtccagcaccatttccggagatggtcaaacattttcaaagcgtcatttccatt
gaatccaagcaacaactgcaggctaaagaaggacagctgccggacatgatcgtagcctgt
gtcggtggcggcagtaacgccattggcagttttgccgcatacattgatgagccttctgta
caactggtcggcgttgaagccgctggtaaaggcgttgatacggcgcgaaccgctgctacg
atcgaacgcggcagtgtcggtattttccacggcatgaaatccttattcatgcaaaacgaa
gacggtcaaatcgatccggtttactccatctctgctggtcttgactaccccggcgttggc
ccggaacacgccgccctcgccgaagcaggccgcgcccaatatgttggaatcaccgatgac
gaagcggttcaggcatttgaatacatcgctagacaagaaggcattgtcgcggcgatcgaa
agctgccacgccattgcttacgttgaaaaaattgccccaaccatggccaaggaccaaatc
atcatctgcaccttatccggccgcggcgataaagatgttgccagcattgccaaatacaaa
ggagttgacgttgatgagtaa

DBGET integrated database retrieval system