KEGG   Lactobacillus rhamnosus GG: LGG_00101Help
Entry
LGG_00101         CDS       T00987                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGG_00101 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGG_00101 (trpC)
Enzymes [BR:lrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LGG_00101 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105711..106490)
Genome map
AA seq 259 aa AA seqDB search
MILDDLVAATRIRLARRQQHQSLTELKRIVAHQPPTTKSDFLTTLKQPGLQVIAEVKKAS
PSKGTIVADFPYMAIAQAYEQAGVDAISVLTEPDYFNGHLRYLKTISQQVSVPTLRKDFT
IDPYMIYEAKANGASIILLIVAILTDQQLRTFRQLAEDLGMQAIVEAYTAEEVTRALQSG
AKIIGINNRNLKNFQVDFTNSLKLRAMVPDSIPVIAESGIQTQQDVEKLAAAGFNAVLIG
ETLMRSKHKRELITAFRGI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagatgatctcgtcgcagcaaccagaatccgccttgctcgccgccaacaacac
caatccttaactgaactaaaacgtatcgttgcccatcaaccaccgaccacaaaatcagac
ttcctcaccaccttaaagcagcctggtttgcaagttatcgccgaggtcaaaaaagcttcg
ccatcaaaaggaacgatcgtggcggattttccttacatggcgattgctcaagcttacgag
caagccggcgtcgatgctatttccgtcctcactgaacctgattacttcaacggccatctt
cgctatttaaagacgatcagccaacaggtctcagtgccgacattgcgtaaagattttacg
attgatccttatatgatttacgaagccaaggcaaatggtgcgtccattattttgcttatt
gttgccatcttaactgatcaacaattacgcaccttccgccaactcgctgaggatctcggc
atgcaagccattgtcgaagcctacaccgccgaagaagtgacccgtgctttgcaatcaggc
gcaaaaatcatcggcattaataaccggaatctgaaaaattttcaggttgattttacaaac
agtctgaaactacgcgccatggttcctgactcgattcctgttatcgccgaaagcgggatc
caaacgcaacaagatgtcgaaaagttagctgcagccggtttcaacgccgtcttaatcggt
gaaaccctcatgcgctccaagcacaagcgggaattaattacggcattcagggggatttga

DBGET integrated database retrieval system