KEGG   Lactobacillus rhamnosus GG: LGG_00101Help
Entry
LGG_00101         CDS       T00987                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lrh01100  Metabolic pathways
lrh01110  Biosynthesis of secondary metabolites
lrh01130  Biosynthesis of antibiotics
lrh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGG_00101 (trpC)
Enzymes [BR:lrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LGG_00101 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth QRPTase_C IMPDH DHO_dh PDZ NMO ThiG Pantoate_transf Dus
Motif
Other DBs
NCBI-ProteinID: CAR85996
Position
complement(105711..106490)
Genome map
AA seq 259 aa AA seqDB search
MILDDLVAATRIRLARRQQHQSLTELKRIVAHQPPTTKSDFLTTLKQPGLQVIAEVKKAS
PSKGTIVADFPYMAIAQAYEQAGVDAISVLTEPDYFNGHLRYLKTISQQVSVPTLRKDFT
IDPYMIYEAKANGASIILLIVAILTDQQLRTFRQLAEDLGMQAIVEAYTAEEVTRALQSG
AKIIGINNRNLKNFQVDFTNSLKLRAMVPDSIPVIAESGIQTQQDVEKLAAAGFNAVLIG
ETLMRSKHKRELITAFRGI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagatgatctcgtcgcagcaaccagaatccgccttgctcgccgccaacaacac
caatccttaactgaactaaaacgtatcgttgcccatcaaccaccgaccacaaaatcagac
ttcctcaccaccttaaagcagcctggtttgcaagttatcgccgaggtcaaaaaagcttcg
ccatcaaaaggaacgatcgtggcggattttccttacatggcgattgctcaagcttacgag
caagccggcgtcgatgctatttccgtcctcactgaacctgattacttcaacggccatctt
cgctatttaaagacgatcagccaacaggtctcagtgccgacattgcgtaaagattttacg
attgatccttatatgatttacgaagccaaggcaaatggtgcgtccattattttgcttatt
gttgccatcttaactgatcaacaattacgcaccttccgccaactcgctgaggatctcggc
atgcaagccattgtcgaagcctacaccgccgaagaagtgacccgtgctttgcaatcaggc
gcaaaaatcatcggcattaataaccggaatctgaaaaattttcaggttgattttacaaac
agtctgaaactacgcgccatggttcctgactcgattcctgttatcgccgaaagcgggatc
caaacgcaacaagatgtcgaaaagttagctgcagccggtttcaacgccgtcttaatcggt
gaaaccctcatgcgctccaagcacaagcgggaattaattacggcattcagggggatttga

DBGET integrated database retrieval system