KEGG   Lactobacillus rhamnosus GG: LGG_00200Help
Entry
LGG_00200         CDS       T00987                                 

Gene name
xfp
Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LGG_00200 (xfp)
Enzymes [BR:lrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LGG_00200 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211677..214058
Genome map
AA seq 793 aa AA seqDB search
MDTKVKTVDYSSKEYFDKMTAYWRAANYVSVGQLYLKDNPLLERPLKSEDVKPHPIGHWG
TIAGQNFIYTHLNRVINKYDLNMFYIEGPGHGGQVMVSNSYLDGSYSEIYPRVSQDKEGM
KNLFTQFSWPGGVASHASAQTPGSIHEGGELGYALSHATGAILDNPDVIAAVVTGDGETE
TGPLAASWFSNTFINPISDGAILPIVHMNGFKISNPTILSRKSDEDLTKYFEGMGWKPYF
VEGDDPTKLNPEMAKVMDAAIEEIKAIQKHARETGDTTMPHWPVIIFRSPKGWTGPKSWN
GEPIEGSFRAHQIPIPVDAEDMEHADSLAGWLKSYHPEELFDENGKLIPELAALPPKGDK
RMAANPITNGGLDPKPLVLPDYRKYALDNTEHGKQIKQDMIVWSDYLRDLIKLNPHNFRI
FGPDETMSNRLYSLFEVTNRQWLEPIKEPADQYMAPAGRIIDSQLSEHQAEGFNEGYTLT
GRHGLFTSYEAFLRVVDSMLTQHFKWIRKAHEEPWHKAYPSLNVVSTSTSFQQDHNGYTH
QDPGILTHMAEKKAEYIREYLPADANSLLAISPKLFSSQNTVNVLITSKQPRPQFYSIDE
ATVLANAGLKRIDWASNDDGVEPDVVIAAAGTEPNMESLAAINLLHDAFPDLKIRFINVL
DLLKLRSPEIDPRGLSDAEFNSYFTTDKPVLFAYHGFEGLIRDIFFTRQNRNVLIHGYRE
EGDITTPFDMRVLNELDRFHLAKDIIQHVPAYAEKAAAFVQKMDDTLQYHHDFIRANGED
IPEVQEWTWKSIK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaagtaaagaccgttgattactcatccaaggaatactttgacaagatgacc
gcttattggcgggcagctaactatgtgtcagttgggcagctttatttgaaggacaatcct
ttgttggaacgaccactgaaaagtgaagatgtgaagccacatccgatcggccactgggga
acgattgctgggcaaaacttcatttatacgcacttgaatcgggttattaataagtacgat
ctcaatatgttctatattgaaggtccgggtcatggtggccaggtcatggtttccaactcc
tacctcgatggttcgtattcagagatttatccacgggtttctcaggataaagaagggatg
aagaacctgttcacccaattttcctggccgggtggtgtggcatcgcatgcgagcgcccag
acgccgggctcaattcatgaaggtggggagctaggttatgcgctgagccatgcaaccggg
gcgattttggataatcctgatgtgattgccgcggttgtcaccggtgatggcgaaacggaa
acgggtccgttagccgcatcttggtttagtaataccttcattaatccaatcagcgacgga
gcaattttaccgatcgtgcatatgaacggcttcaagatttctaacccaacgattctgtct
cggaaatcagatgaagatctgaccaagtactttgaaggcatgggttggaagccatacttt
gttgaaggcgatgacccaaccaagctcaatcctgagatggcaaaagttatggacgctgcg
atcgaagaaatcaaagcgattcaaaagcatgcccgtgaaaccggcgatacgacaatgccg
cattggccagtgattattttccgctcaccaaagggctggacgggtcctaagagctggaat
ggcgaaccaatcgaaggctcgttccgtgcgcatcagattccgattccggttgatgctgaa
gatatggaacatgccgattcgttggctggctggctgaagtcgtaccatccagaagaatta
ttcgatgaaaatggcaagttgattccggaactggccgcgttaccgccaaagggtgacaaa
cggatggccgctaacccgatcaccaatggcgggcttgatcctaagccattagtattacct
gattatcgcaagtatgcactggataataccgagcatggcaagcaaattaagcaggatatg
attgtgtggtcagactatctgcgtgatttgatcaagctgaacccgcataatttccggatc
tttggccctgacgaaaccatgagcaaccggctttacagtctgtttgaagtcaccaaccgc
cagtggctggaaccaattaaggagccagctgatcaatacatggcaccggctggccggatt
attgattcgcagctgtcagaacaccaggcggaaggctttaatgaaggctatacgctgact
ggccggcatggtttgttcacaagctatgaagcattcctgcgcgtggttgattcgatgctc
acccagcacttcaagtggattcgtaaggcccatgaggaaccatggcacaaggcttatcca
agcttgaacgtggtttcgacttcgacgtccttccaacaggatcacaacggttacacccat
caggatccaggcattttgacccacatggcggagaagaaagccgaatacatccgcgaatat
ctgccagctgatgcgaatagtttattggccatttcaccaaaactattcagctcacaaaac
acggttaatgtgctgattacttccaagcagccgcggccacagttctacagtattgatgaa
gcaactgttttggccaatgctggcttgaaacggattgattgggcttccaatgatgatggt
gttgagccggatgttgtcattgctgctgccgggaccgagccaaacatggaaagccttgct
gcaatcaacttgttgcatgacgccttcccagacttaaagattcgcttcattaacgtgctt
gatcttttgaagctgcgcagtccagaaatcgatccgcgtgggttgagtgatgctgaattc
aacagttacttcacgacggataagccggttctgtttgcctatcatggctttgaaggcttg
atccgtgacatcttctttacccgtcagaatcgtaacgtcctgattcacggttatcgtgaa
gaaggcgatatcacaacgccatttgatatgcgggttctaaacgaacttgatcggttccac
ttggccaaggatatcattcagcatgtaccggcatatgctgaaaaagcggctgcctttgtt
cagaagatggatgatacgttgcaatatcaccacgacttcattcgggcaaacggcgaagat
attcctgaagttcaggagtggacttggaagtcaattaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system