KEGG   Lactobacillus rhamnosus GG: LGG_00336Help
Entry
LGG_00336         CDS       T00987                                 

Gene name
bgaC
Definition
beta-galactosidase (GH35)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LGG_00336 (bgaC)
Enzymes [BR:lrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LGG_00336 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340323..342104
Genome map
AA seq 593 aa AA seqDB search
MTTFSIDHEFMLDGKPFKILSGAIHYFRVHPSDWYHSLYNLKALGFNTVETYVPWNLHEY
REGEFDFSGILDIERFLKTAEDLGLYAIVRPSPYICAEWEFGGFPAWLLTKKMRLRTDDP
AYLAAIDRYYTALMPHLVDHQVTHGGNVIMMQVENEYGSYGEDQDYLAAVAKLMQQHGVD
VPLFTSDGPWPATLNAGSMIDAGILATGNFGSAADKNFDRLAAFHQEHGRDWPLMCVEFW
DGWFNRWGEPIIRRDPDETAEDLRAVIKRGSVNLYMFHGGTNFGFMNGTSARKDHDLPQV
TSYDYDAPLNEQGNPTPKYFAIQKMIHEELPEVQQAKPLVKPTMAPASHPLTAKVSLFAV
LDQLTKPIAASYPQTQEFLGQYTGYTLYRTQPLISGTDKGTPAKLRVIDARDRVQAYLDQ
KWLATQYQEAIGDDILLPEVEGHHQLDLLVENMSRVNYGSKIEAITQFKGIRTGVMVDLH
FIKGYQQYPLDLNRASRLTFTEGWQPATPAFYKYTFDLTAPQDTYLDCRGFGKGVMLVNG
VNVGRFWEKGPTLSLYVPAGLLHAGKNDVIVFETEGRYAESLKMADHPIFKEP
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccttttcgatcgatcatgaatttatgttggatgggaagccgttcaagatccta
tctggtgccattcattattttcgggtgcatccgagtgactggtatcacagcctgtataac
cttaaagctttagggtttaacacggtggaaacctatgtgccgtggaacttgcatgagtat
cgtgaaggcgagtttgattttagcggcatcctcgatattgaacgttttctcaaaactgct
gaagatctcggcttgtatgcgattgtgcggccgtctccttatatctgtgcagagtgggag
tttggcggatttccggcatggctgttgacgaagaagatgcgtctgcgtactgatgatcca
gcttatttggcggcaattgaccgttactataccgcattgatgccgcatctagttgatcat
caagttacccacggcggcaatgtgatcatgatgcaggtggaaaacgagtacggttcttat
ggtgaggatcaggattacttggcggcggttgcgaaactgatgcagcaacacggagttgat
gtgccgttgttcacttcagatggaccgtggccagccaccttaaacgccgggagtatgatt
gatgccggcattctggcaacgggcaacttcggctcggctgccgataagaatttcgatcgg
ttagccgcttttcatcaggaacacggtcgcgactggccactgatgtgcgtggaattctgg
gatggttggtttaaccgctggggtgagccgattatccgccgcgatcctgatgaaaccgcg
gaagatctgcgcgccgtcatcaagcgtggcagtgtgaatctctacatgtttcatggtggt
acaaattttggcttcatgaacgggacgtctgcgcgtaaagaccatgacctgcctcaggta
acatcttacgattacgatgccccgctaaatgaacaaggtaatccaacgccaaagtacttt
gccattcaaaaaatgatccatgaagagcttccagaagttcagcaagccaagccgctggtc
aaacccacgatggcgccagcttcacacccgttaacggctaaagtttccttgttcgcagtc
ttggatcagttaaccaaaccgatcgccgcttcttatccgcagacgcaagaatttctgggc
caatataccggctataccttgtatcgtacgcagccgctcattagtggcactgacaaagga
acaccggccaagttgcgggtgatcgatgcccgtgatcgggtgcaagcttatttggatcaa
aaatggctagcaacccaataccaagaagcaattggtgatgatatcttgttgccggaagtt
gagggacatcatcaacttgatttactggtagaaaacatgagtcgggtgaattacggatcc
aagattgaggcgatcacgcagttcaaagggattcgcaccggtgtcatggttgatctgcac
ttcatcaagggctatcagcaatacccgctggacttgaatcgcgcttctcggcttaccttt
acggaaggctggcagcccgcgacccctgcgttttacaagtacacgtttgatttgaccgcc
ccgcaagatacctatcttgattgtcgtggattcggtaaaggagtgatgctggttaatggt
gtaaatgtcggcaggttttgggagaaaggccccacgttgtcactttatgtaccggcagga
ctcctgcacgccggaaaaaatgacgtcattgtgtttgaaaccgaaggccgctacgccgaa
agcttgaagatggctgaccacccgatatttaaagaaccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system