KEGG   Lactobacillus rhamnosus GG: LGG_00434Help
Entry
LGG_00434         CDS       T00987                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase (GH3)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LGG_00434 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LGG_00434 (nagZ)
Enzymes [BR:lrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LGG_00434 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436451..438265
Genome map
AA seq 604 aa AA seqDB search
MTDADINAYISNMTLDQKIGQMFVSRTLQDTDKARSDIAKYNLGGLIVYGADFTSVEGKT
ATEAQNNFKMKVQSFQNSASLPLLIGVDQEGGTVSRLSQNPLIANGRSFPSPQTAYANGG
MANVTKEASEVGTILKNLGINWNYAPVADSTPDTSSFIYGRTFGQDYLATANYITNVIPA
WQNAGVAATLKHFPGYGSAIDTHTDFAVVTKSKADFEKEDLLPFKSGITAGADSVMIAHI
VMQAVDPVYPASLSRKVVTDLLRNELGYNGLIITDALEMGAIKQFAQEHDQVPVDVLAVE
AGNDCIMNNDYETAIPQIHAAVTSGTIKESEINEHVFRILDLKRKLGLLTKAQLQQKKVQ
IDNVSYSSDNKKATVSGTVVDSDWQVGEPLSVKDSTGKVIITADVGAGGKFTFDIPTNSQ
EQVLTLTTNLPNIADAKITIKAVSSSNTNKTLLENLIKSVEKLASNQYTVKSWQELQAKL
TESKSILNNDSATQDQVDASVNALQSALKQLVSASNSENNSQNSNDSSSQSSSNTGGQAS
SSTSNANETNIASKDLSGTKSDKGSKDNHGFLPSTGERVMAGISVLGVILIACVTVLYIR
KKRA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatgccgatattaatgcctatatttctaatatgaccttagatcaaaagattgga
caaatgtttgtgtctcgaacattgcaagatacggataaagctcgatctgatatagcaaaa
tacaaccttggtgggttgattgtatatggagctgatttcactagtgttgaaggaaaaaca
gctaccgaagcacagaataatttcaagatgaaggtgcaaagttttcaaaactcagcaagc
ctgccgttattgattggtgttgatcaagagggaggaacagtttcacgcttatcacaaaat
cctctaattgcgaatggtagaagctttccttcaccacaaacggcttatgctaatggcgga
atggccaatgtaacaaaagaggctagtgaagtcggaactattctaaaaaatctgggcatc
aattggaactatgcaccagtagctgacagcacgcctgatacttctagttttatttatggc
agaacttttggtcaagattacttggcaactgcaaactatattacgaatgtgatccctgca
tggcagaatgctggtgttgcagcaacgcttaaacattttccgggttacggatcagcgatt
gatacgcatacggattttgcagttgttacaaaatctaaggcggattttgaaaaagaggat
ttgcttccctttaaatccggtattacagcaggagcagattcagtaatgattgcacatatc
gtaatgcaagctgttgacccagtatacccagcttcattatcacgaaaggtcgttacagac
ttgttgcgtaatgaacttggttataatggcttaatcattaccgatgcattggaaatggga
gctatcaagcaatttgctcaagaacatgatcaagttcctgttgatgttcttgctgttgaa
gcaggaaatgattgcatcatgaataatgattatgaaaccgctattccacagattcatgca
gcagtaactagcggcactattaaggaatcagaaatcaatgaacacgttttccgcattcta
gatctcaaacgcaagttagggctgttaactaaagcgcaacttcagcaaaaaaaggttcag
attgacaatgtttcctacagcagtgacaacaaaaaggcaacagttagcggcacagttgtt
gatagtgattggcaagttggagaaccgttatcggttaaagactcaactggaaaggtcatt
attaccgcagacgtcggggccggtggtaagtttactttcgatattcctactaattcccaa
gaacaagtattaactctgaccactaatctacccaatatcgctgatgccaaaataactatt
aaggctgtgagttcatcgaatactaacaaaactttgctagaaaacttgattaaatctgtt
gaaaaattagctagcaatcaatatactgtcaagtcttggcaagagttgcaagctaaacta
actgaatcaaaatcaattttaaacaatgatagtgctacacaagatcaagtagatgcttcc
gttaatgctttgcaaagtgcccttaagcaattagtttctgcatcaaatagcgaaaataat
agtcaaaactctaatgatagcagttcccaaagttcatctaacactggtggacaagcatca
tccagtactagtaatgctaatgagactaatattgctagtaaggatttgtcaggtacaaag
tcggataaaggatctaaggacaatcacggttttttgccaagtacgggtgaacgcgtgatg
gcaggaatttctgttctgggggtaattttaatagcttgcgtgactgtattatatattcga
aaaaaaagggcataa

DBGET integrated database retrieval system