KEGG   Lactobacillus rhamnosus GG: LGG_00470Help
Entry
LGG_00470         CDS       T00987                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LGG_00470 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LGG_00470 (ebgA)
Enzymes [BR:lrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LGG_00470 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477195..480173
Genome map
AA seq 992 aa AA seqDB search
MTTAKLWEQPELTDINRMVPRSHFQTFFPGEDSQPRNYQLLNGTWQFKFLDAPEYAPENF
MNSDFDDQDWDQIPVPSNWQLQGYGKMHYSDLWYNFPINPPFVPSENPTGLYRRTFTVDE
VVDNEQYIIGFDGADSAFKLYLNGEFIGYSKGARLPSEFDVTQALKQGVNTIAVEVVQWS
DGTYLEDQDMWWLSGLFRDVSLYSRPQNGLYDVQVRTYLLKDYRAGELVVTPIVSGTEPL
KIHYELAKDGAKLIDQVLSADASLDVTLDDIQAWSAEAPNLYDLTMTVLQDNEPLEVVRQ
RVGFRQIELNGKTFLVNGKAIKFKGVNMHDYSATKGRVMTRNDFVKNISLMKQNNINAIR
TSHYPKAPYFYDLCDELGMYVIDETDLECHGFELTERYDWITDDPRWKTAYVDRMRRTLQ
RDKNHPSIIIWSLGNESDFGDNFRAMAAYCKREDPTRLVHYEGDFEAEVSDVYSTMYTWL
EHDTKMTMADVLRKTQKPHILCEYAHSMGNGPGNLKEYQDLFYGHEQLQGGFIWEWFDQG
VASQKDGQTYYRYGGDFGDQPNNGNFCIDGLIRPDGNPSTALTEVKKTFEPFQILVRDLP
TQTVTVINRLDFLNSDYFDFGYELEANGQVIADGKLDIPTILPGHQQTVKLNLDLPEFDP
SVIYNLHLVTHLKNKTAWANAGTVLSQSVMTLQRPKHQLNHQTIVALQASENKTTIEIKG
GANAYRFDKIKGTFTLTHDGRVLIHDGIKMNFWRAPIDNDMYLLDDYYNKYFLNLWHEST
REVQLQPQTNGDYVVNLVKQVGTTNSGWYYQITQRYTLHQDGSFDLDVIGKASGKRDMAP
EMLPRIGVKMTLPKDFQQVAYDGLGPTENYSDSHQAAYYSHFTSRVDDLFVNYVKPQENG
NHMDTDRLALMNGQDQLTLTMMKPLNFSVSNYADETLEAAKHTIDLKKSDELNLYLDFRQ
NGLGTNSCGQNQLKRHRCKFDDFELGFNFKIN
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcaaaattgtgggaacaacctgaactaaccgatatcaatcggatggttcct
cgtagccattttcagacattcttcccaggcgaggatagtcagccgcggaattatcagtta
ttaaatgggacttggcagtttaagttcttggatgcgccggaatatgcgccggaaaatttc
atgaacagcgactttgatgatcaggattgggatcaaattcctgtacctagcaattggcag
ctgcaaggttatggcaagatgcattattctgatctgtggtataacttcccaatcaatccg
ccctttgtaccgagtgaaaatccaactgggttgtatcggcgaacctttacggtggatgag
gtagttgataacgaacaatacatcattggcttcgatggggcagattcggcttttaagttg
taccttaacggcgagtttatcggctatagcaaaggtgcccgtttgccaagtgagtttgat
gtcacgcaggcattaaaacaaggtgttaatacaattgccgttgaagtggttcaatggtct
gatggtacgtatcttgaagaccaggatatgtggtggttgagcggcttgttccgtgatgtg
agtttgtattcgcgaccacaaaacgggttatatgatgtgcaggtacgaacctatttattg
aaggattatcgtgcgggtgaactagtcgtcacaccgatagtatccgggacggagccgtta
aagattcattatgaactagccaaagacggggctaaattgattgaccaagttctttctgcc
gatgcttctttggatgtcacgctggacgacattcaggcgtggtctgctgaagcgcctaat
ctttatgatttaacgatgacagtgttgcaagataatgagccgcttgaagtggttcgtcag
cgggtcgggttccgccaaattgagttgaatggcaagacgttcttggtcaatggcaaagca
atcaagtttaaaggcgtcaacatgcatgattacagcgctaccaagggccgagtgatgacg
cggaatgattttgttaagaacatcagcctgatgaaacaaaacaatatcaatgcgattcga
acgtctcactaccctaaagcaccgtatttctacgacctgtgcgatgaacttggtatgtat
gtcattgatgaaacagatttggaatgtcacggctttgagttgactgaacgctatgattgg
attaccgatgatccacgctggaagactgcatatgtagatcggatgcggcggactttgcaa
cgcgataagaatcatccttccattatcatttggtcgttaggcaatgaatcagactttggc
gataattttcgggcgatggctgcatattgtaagcgagaggatccaacgcgactcgtccat
tacgaaggtgattttgaagctgaagtcagcgacgtttattcaacaatgtacacgtggttg
gaacacgatactaagatgacaatggcagatgtattacgtaagacgcagaagccccatatc
ttatgcgaatatgcacactctatgggcaatgggcctggcaacttgaaggaataccaggat
ctcttttacggacatgaacaactgcaaggtggattcatctgggaatggtttgatcaaggg
gtagcatcgcaaaaggatggtcaaacctactatcgttatggtggtgactttggcgatcag
cccaataacggaaacttttgtatagatgggttgatccgcccagatggcaatccgtctacg
gctttaaccgaggtcaagaagacgtttgaaccgttccagatccttgttcgtgatctgcca
acgcaaacggttacggtgattaatcgactggactttctaaattctgattactttgatttt
ggttatgaacttgaagcaaatggtcaagtgattgctgatggcaagcttgatatcccaact
attttgccaggtcaccaacagaccgtgaaacttaatctcgatttgccggagtttgaccct
agtgtcatttataaccttcatttggttacgcatctcaaaaacaagactgcttgggcgaat
gctggaacagtgctttctcaatctgtcatgaccttgcaacggccaaaacaccaattgaac
catcagacaatcgtggcactacaagcaagtgaaaataaaacgacaatcgaaatcaaaggc
ggtgcgaatgcataccggtttgacaagattaaaggtaccttcacattgacacatgatggt
cgtgtcctgattcatgatggcatcaaaatgaatttctggcgcgcccctatcgacaacgac
atgtatctgttagatgactattacaacaaatatttcctgaacctatggcatgaaagtacc
cgcgaagtccaattacagccgcaaaccaacggcgattatgtcgttaatctagtcaagcaa
gtgggcacgaccaatagtggctggtattaccaaatcacacaacgctacacattacatcag
gatggaagttttgatcttgatgtgattggtaaggcaagtggcaaacgtgacatggcacca
gagatgctaccgcgaattggggtaaagatgacgttgccaaaagatttccagcaagttgcc
tatgacggactgggaccaactgaaaactatagtgactctcatcaagctgcctactacagt
cattttacgagtcgggttgatgacctctttgtcaattatgtaaaaccgcaagaaaatggt
aatcatatggacactgatcgattagcactgatgaacggtcaggatcaattaaccttgacg
atgatgaagccattgaacttcagtgtgtcaaactatgcggacgaaactttggaggccgca
aaacacaccattgatttgaagaaatcagatgagctcaatctatatcttgatttccggcaa
aacggacttggcacgaactcgtgcggccaaaatcaattaaagcgtcatcgctgcaagttt
gatgattttgaacttggatttaacttcaagatcaactag

DBGET integrated database retrieval system