KEGG   Lactobacillus rhamnosus GG: LGG_00644Help
Entry
LGG_00644         CDS       T00987                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LGG_00644 (glpK)
Enzymes [BR:lrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LGG_00644 (glpK)
Exosome [BR:lrh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LGG_00644 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(657115..658632)
Genome map
AA seq 505 aa AA seqDB search
MTNEQQYILAIDEGTTSTRTIIIDHNGQKVADAQREFPQYFPHPGWVEHNANEIWNAALS
TIATAFIESHIQPRQIVGIGITNQRETTVVWDKQTGLPIYNAIVWQSRQTSDIADQLKAD
GYADLVHDATGLLIDSYFSATKIRWILDHVPGAQERAENGELLFGTIDTWLSWKLSGGAI
HVTDYTNASRTMLFNIHKLDWDDEILRILNIPKQMLPEVRSNSEIYGDAAAYHFFGSTVP
IAGMVGDQQAALFGQLAIEPGMVKNTYGTGAFIVMNTGDKPTLSNHNLLTTIGYGLNGKI
TYALEGSVFVAGSAIQWLRDAMKLIERSSDSEAAALASKSQNEVYVVPAFTGLGAPYWDS
DARGAIFGITRGTTREDFIKATLQSLAYQSRDVVDTMNKDTGMPIPALRVDGGAANNDYL
MQFQADILGIPIERAANLETTAMGAAFFAGLATGFWNSTDELQSIVKVGKRFEPTMDVSD
RESLYEGWKQAVAATQQYKHTTKQD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacgaacagcagtatattctggcgattgatgaaggaacaaccagcacgcgtacc
atcatcatcgatcacaatgggcaaaaagttgctgatgcccagcgcgaatttccacagtat
tttccacatcctggttgggttgaacataacgcaaatgaaatctggaatgctgcgttatcc
acgattgccacagcgtttatcgaatcgcatattcaaccacgccaaattgttgggatcggc
attacgaatcagcgggaaacaacggtcgtgtgggataagcaaaccgggctgcccatttac
aacgccattgtctggcaatcccgtcaaaccagcgacattgcagatcaacttaaagcggat
ggctatgctgatctggttcacgatgccaccggtttgctaattgattcctacttctctgct
accaaaattcgctggattctggatcatgtaccaggggcgcaggaacgggccgaaaatggt
gaactgctttttggcaccattgacacttggctatcatggaagctttctggcggtgccatt
catgtcaccgactacaccaatgcttcacgaaccatgctcttcaatatccacaagttggat
tgggatgatgagatcttacggattctcaacatccccaagcaaatgctgccggaagttcgc
agcaattcagaaatttatggggatgcagcagcctatcatttcttcggcagtaccgttccc
attgccggtatggtcggggatcagcaagcagcattattcggacagctggctatcgaaccg
ggaatggtcaaaaacacgtatggcaccggtgcctttatcgtcatgaataccggcgataag
ccaaccttgtcgaatcataatctgctaaccaccattggctacggactcaacggtaagatc
acttatgccttggaaggttcggtctttgtggctggcagcgccattcaatggttacgtgat
gccatgaaactgattgaacgttcaagcgactccgaagctgccgcactagcatccaagagt
caaaacgaggtctatgtcgtccctgcctttactggtttaggtgctccttactgggattcg
gacgcacgtggcgctattttcggaattacccgtggaacaactagggaagacttcatcaag
gcaacgttacaatcgcttgcttatcaatcccgtgatgttgtcgacacgatgaacaaggat
accggcatgccgattccagctctgcgcgttgatggcggggctgctaataacgattacctc
atgcagtttcaggctgacatccttggtattccgattgaacgcgccgccaaccttgagacc
actgccatgggtgccgccttctttgccgggctagcaaccggattctggaacagcacagat
gaactccagagcatcgtcaaggtcggtaagcgctttgaaccgaccatggacgtttcggat
cgggaatcactttacgaaggctggaaacaagccgttgccgccacccagcagtacaaacac
accaccaagcaagactaa

DBGET integrated database retrieval system