KEGG   Lactobacillus rhamnosus GG: LGG_00757Help
Entry
LGG_00757         CDS       T00987                                 

Gene name
adhE
Definition
(GenBank) Aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh00010  Glycolysis / Gluconeogenesis
lrh00071  Fatty acid degradation
lrh00350  Tyrosine metabolism
lrh00620  Pyruvate metabolism
lrh00625  Chloroalkane and chloroalkene degradation
lrh00626  Naphthalene degradation
lrh00650  Butanoate metabolism
lrh01100  Metabolic pathways
lrh01110  Biosynthesis of secondary metabolites
lrh01120  Microbial metabolism in diverse environments
lrh01130  Biosynthesis of antibiotics
lrh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGG_00757 (adhE)
   00620 Pyruvate metabolism
    LGG_00757 (adhE)
   00650 Butanoate metabolism
    LGG_00757 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LGG_00757 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LGG_00757 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LGG_00757 (adhE)
   00626 Naphthalene degradation
    LGG_00757 (adhE)
Enzymes [BR:lrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LGG_00757 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LGG_00757 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAR86652
Position
767261..769867
Genome map
AA seq 868 aa AA seqDB search
MLKNTAKAATEVDVKGMIDELVANAHSALKIMKTFDQEKIDHIVHRMAIAGLDHHMELAK
LAVDETGRGVWEDKAIKNMFATEEIWHSIKNNKTVGVINEDKQRGLVSIAEPIGVIAGVT
PVTNPTSTTIFKSEISIKTRNPIIFAFHPGAQKSSARALEVIREEAEKAGLPKGALQYIP
VPSMEATKTLMDHPGIATILATGGPGMVKSAYSSGKPALGVGAGNAPAYIEASANIKQAV
NDLVLSKSFDNGMICASEQGAIVDSSIYDAVKKEFEAQGAYFVKPKDMKKFESTVINLEK
QSVNPRIVGQSPKQIAEWAGIRIPDDTTILIAELKDVGKKYPLSREKLSPVLAMVKADGH
EDAFKKCETMLDIGGLGHTAVIHTADDELALKFADTMQACRILINTPSSVGGIGDLYNEM
IPSLTLGCGSYGGNSISHNVGTVDLLNIKTMAKRRNNMQWMKLPPKIYFEKNSVRYLEHM
EGIKRAFIVADRSMEKLGFVKIIEDVLARRENPVQVQTFVDVEPDPSTDTVFKGTDIMRS
FGPDTVIAIGGGSVMDAAKGMCLFNDAGDADFFGAKQKFLDIRKRTYTFPKLNKTKLVCI
PTTSGTGSEVTPFAVITDSKAGIKYPLADYALTPDIAIVDSQFIESVPPVVVADSGIDVL
CHATESYVSTMATHYTKGLSLEAIKLVFENLEKSYHGDIAAKSKMHDASTIAGMAFANAL
LGINHSIAHKLGQAFHLPHGRCIAITMPHVIRFNASQPKKRAIWAKYSYFRANEDYAEIA
RYLGLPGKTTDELVESYVQAFIKLAHSVGIKLSLKDQGVQKADLDKQVDRLAELAYEDNC
TVTNPQEPLISDLKHIILDEYEGTDSTF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagaatactgcgaaggctgctactgaagttgatgtgaaaggcatgattgatgaa
ctggttgccaatgcgcactcggctttgaagatcatgaagacttttgatcaagaaaaaatt
gatcatattgttcatcggatggcaattgccgggttagatcatcatatggaattagcgaaa
ctcgctgttgacgaaaccggccgtggtgtttgggaagataaagccattaaaaatatgttt
gccactgaagaaatctggcattcgattaagaacaacaagaccgttggcgttatcaatgaa
gataaacaacgcggcttggtatccatcgccgaaccaatcggggttattgccggggtaacg
ccggtgaccaacccgacatcaaccacgatctttaaatccgaaatttccatcaagacccgt
aatccgattatctttgctttccacccgggtgcacaaaagtcttcagcgcgtgcgttggag
gtcattcgggaggaagctgaaaaggccggattgccaaaaggggccttgcagtatattccg
gttccaagcatggaagcaactaagacactgatggatcatcccggcattgccacgatcttg
gcaaccggtggccctggcatggttaagtcagcttattcatccggcaaaccggccttgggt
gttggcgcagggaatgcaccggcatacatcgaagcaagtgccaatattaagcaagccgtt
aatgatttggtcttgtccaagagttttgataacggtatgatctgtgcttccgaacaaggg
gccatcgttgattccagcatttacgatgccgtgaagaaagaatttgaagcccaaggtgcc
tattttgtcaaacctaaggacatgaagaagttcgagagcacggttattaaccttgagaag
caaagtgttaatcctcgaattgttggccaaagtcctaagcaaattgctgaatgggcaggg
attcgaattcctgatgacacgaccatcctgattgccgaactaaaagacgttggcaagaaa
tatccgctttctcgggaaaaactgagcccggttttggcgatggttaaagccgatggtcat
gaagatgccttcaagaaatgtgaaaccatgttggatatcggcggcttgggacacaccgcg
gtgattcacacagctgacgacgaattggcattgaaatttgctgataccatgcaggcttgc
cgaatcctgatcaatacaccttcttctgttggcggtatcggggatctctacaacgaaatg
attcctagtttgacgctgggctgcggctcctatggcggcaactcgatttcgcacaatgtg
gggacggttgacttgttgaatatcaagaccatggcaaaacggcgcaacaacatgcaatgg
atgaaattgccgccaaagatttatttcgaaaaaaactcggttcgctatctggaacacatg
gaaggcatcaagcgcgccttcatcgttgctgatcgttcaatggaaaagctgggtttcgtc
aagatcattgaagacgttttggctcggcgcgagaatccggtacaggttcagacgttcgtg
gatgttgaacctgatccatcaactgatacggtcttcaagggaaccgatatcatgcggtcg
tttggtccggataccgtgatcgcgattggcggtggttctgtaatggatgcagccaagggt
atgtgcttgttcaacgatgctggcgatgcggacttcttcggtgccaaacagaaattcctg
gatattcggaaacggacctacactttcccgaagctgaataagaccaaactggtttgcatt
ccgacgacttccgggaccggttctgaagtgacaccatttgcggttatcaccgattccaaa
gcagggatcaaatatccgttagctgattatgctttgacgccagatattgcgattgtggat
agtcagtttattgaatcagtaccgccagtagttgtggctgattccgggatcgatgttttg
tgccatgcaaccgaaagttatgtatcaaccatggcaacccactatacgaagggcctgagc
cttgaggcaatcaagctagtgtttgaaaacctcgaaaagagttatcatggcgacattgcg
gctaagtcaaagatgcatgatgcttctaccattgcagggatggcgtttgccaatgccttg
ctgggaattaaccacagtattgcccataaattaggtcaggcgttccacttgcctcatggt
cgctgcatcgccatcaccatgccacatgttatccggttcaatgctagtcaaccaaagaaa
cgtgcaatctgggccaagtacagttacttccgtgctaacgaagactatgcagaaattgcc
cgctatcttgggctgccaggaaagaccaccgatgaattagtggaaagctatgttcaagcc
ttcattaaattggcacatagcgtcgggatcaagttaagtctgaaggatcagggagttcag
aaagcagatctggacaagcaagttgatcgccttgctgaacttgcttatgaagataactgc
acggttaccaacccgcaggaaccattgatcagcgatttgaagcacattattctcgatgaa
tatgaaggaacggattcaacattctaa

DBGET integrated database retrieval system