KEGG   Lactobacillus rhamnosus GG: LGG_00935Help
Entry
LGG_00935         CDS       T00987                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGG_00935 (tpiA)
   01230 Biosynthesis of amino acids
    LGG_00935 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGG_00935 (tpiA)
   00051 Fructose and mannose metabolism
    LGG_00935 (tpiA)
   00562 Inositol phosphate metabolism
    LGG_00935 (tpiA)
Enzymes [BR:lrh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LGG_00935 (tpiA)
Exosome [BR:lrh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LGG_00935 (tpiA)
  Exosomal proteins of bladder cancer cells
   LGG_00935 (tpiA)
  Exosomal proteins of melanoma cells
   LGG_00935 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943036..943791
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQAFLDAVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMGVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
DSFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaccattcattgctggtaactggaaaatgaataagaatcctaaggagacgcaa
gccttcttagatgctgttaagggtaagttacctgatgcaagcaaagttgaaacagtcatt
ggcgcacctgccattgatctaacgacgctggttgccggtgcagaaggtactcctttgaag
acagcggcggaaaactgctactttgaagacgaaggtgcttttaccggcgaaaccagcccg
aaagccttaaaagaaatgggcgttgattacgtcattatcggtcacagtgaacgtcgcggt
tatttccacgaaaccgacgaagatatcaacaagaaggctaaggccatctttaagaacaat
cttttgccgattatctgctgtggtgaaagtttggctcagcgtgaagccggtcaaaccgaa
gattgggttgcttctcaaatcgaagcagctttggcaggcttaagtgccgaccaagttaag
gtttcggttttggcttacgaaccaatctgggctatcggcactggtaaaacagcaactgca
gatcaagcacaagaagttgttgctcacatccgtgcaaccgttgagaagttgtataataaa
gatacggcagatgctgttcggattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatattgatggtggcttagttggtggcgcttcgatggatcct
gacagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system