KEGG   Lactobacillus rhamnosus GG: LGG_00941Help
Entry
LGG_00941         CDS       T00987                                 

Gene name
yvaK
Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lrh  Lactobacillus rhamnosus GG
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
948648..949382
Genome map
AA seq 244 aa AA seqDB search
MIFRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRAGYGVYVPLFSGHGTVEPLD
ILTKGNPDIWWAESSAAVAHMTAKYAKVYVFGLSLGGIFAMKALETLPGITAGGVFSSPI
LPGKHHLVPGFLKYAKYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPT
FIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQ
ENEG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattttccgcaaaccacaaccattcgaatatgaaggtaccgatactggcgtggtattg
ttacatgcatacacgggtagccccaatgatatgaattttatggcgcgggccttgcagcga
gccggttatggggtttatgttccgcttttttccgggcatgggacagtggagccgttagat
attttgacaaaaggcaacccggatatttggtgggcagaaagtagtgccgcggttgcgcat
atgaccgcaaaatacgccaaggtgtatgtttttggcttatcactgggaggtattttcgcg
atgaaggcgctagaaaccttgccagggattacagcaggcggtgttttttcatccccgatt
ttgccgggcaaacatcacttagtaccgggttttttaaagtatgccaagtatatgaatcgg
ttagcaggcaaatcagatgaaagcacacagattctggcatatttgccgggacagttggcc
gcaatcgatcagtttgccacgacggttgctgctgatttaaatttagtcaaacagccgact
tttattggacaagccggtcaggatgaattagttgatggtcgattagcgtatcaattacgc
gatgccttaatcaatgctgcacgcgttgattttcattggtatgatgatgccaagcatgtc
attaccgttaactcggcccatcacgcattagaagaagacgtaatcgcatttatgcaacaa
gaaaacgagggatag

DBGET integrated database retrieval system