KEGG   Lactobacillus rhamnosus GG: LGG_01001Help
Entry
LGG_01001         CDS       T00987                                 

Gene name
galA
Definition
alpha-galactosidase (GH36)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LGG_01001 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    LGG_01001 (galA)
   00600 Sphingolipid metabolism
    LGG_01001 (galA)
Enzymes [BR:lrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LGG_01001 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1011649..1013943
Genome map
AA seq 764 aa AA seqDB search
MIDVTDDHAFHLYNQKISYICALLPNGQLGHLYFGPRLSLTTADLTYLSQGSSPFAWMAN
FSDDQPFALGDAQQEYPVYGTGDFRQGSLSVTQADAPVYPNFVFKDYQVSHTKMRNLHHP
TSFGNPALTDVLTIHLEDETAQLLLTLQYTIFSDSATVVRAATLTNQGAEPVMIERMLSG
ALNLPQGRYDVVHLSGNWAKERHIQTQPLTQGTFSVESLRGASSHEQNPFVALHAAGQPF
AVGDAYGANLVYSGNFLDSIEVNEWDQTRLLAGIHPAYFSWRLDPKTSFTTPEVVLSFSS
AGLAGLSQVNQRFVARHIIDPQWRQKPRPVVLNSWEATYFDLNEQKLLHLAKLGRQVGVD
CFVLDDGWFGTRDNDLSSLGDWFTNKHKFPDGLGHFAEEIHGLGLQFGLWFEPEMVSPRS
QFFQKHPDWVVRPKRGRMSITRHQYVLDFSNPAVVNNIFAQMQRVITETKLDYVKWDLNR
SITEAYSPYLAKIGHPQGEFFHCYVQGVYTLYQKLLTAFPHLLIEGCAGGGGRFDLGILF
YSPQIWTSDDSDAIERLAIQSGTALAYPLSCMSNHVTAIPNEQVGRSTPLATRFRVAAFG
ILGYELDLTKLDDAALATIKNQIAYYHELQPLVLNGDFRLLLPRQSNSQNQVAWLLSDHY
RKRLVLGFFRVLADADSRAVQYMKIPVAQPNQRYWVNGHTGPVSGDVLQRVGVRLPIQFN
GANRQQAQLIGDYQSALLTFDGVTATKTGKHQPEIRKQQKVGHA
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgatgttactgacgatcatgcttttcatttatataatcaaaagatcagctatatt
tgtgcgttattgccaaatggtcagttgggccatctctattttggccccagattatcgtta
acgactgctgatttgacctatctatcgcaaggttccagtccgtttgcgtggatggctaac
ttttccgacgatcagccgtttgcattaggtgatgcgcaacaagagtatccagtttatgga
actggcgattttcggcaaggcagtttaagtgtgacccaagcagacgcacccgtgtatccg
aattttgtatttaaagattatcaggtgagtcacaccaagatgcggaatttacatcatcca
acgagctttggtaatccagccctgactgatgttttgacaattcaccttgaagatgaaacg
gcgcagttattattaacgctgcagtatacgattttttcggatagtgccacggtcgttcgg
gcagctactttgacgaaccaaggtgctgagccggttatgattgagcggatgttgagcggg
gcgctgaatttaccccaaggccgttatgatgttgttcacttgtcaggtaactgggccaaa
gagcggcacattcagacacagcctttgacgcaaggaacgttttcagtggaatctttgcgc
ggggcatcgagtcatgaacaaaatccgttcgtcgcattgcacgcagccggacaaccattt
gctgttggcgatgcttacggtgcgaacttagtctattcggggaactttctggatagcatt
gaagttaatgaatgggatcagacgcggcttttggctggcattcatccggcttattttagc
tggcgactagatccgaaaaccagttttactacccctgaagtggtcttaagctttagttca
gcgggactagctggtttatcccaagtcaatcagcgttttgtggcccggcatattattgac
ccgcaatggcgccaaaagccgcgtccggttgttttgaacagttgggaagcgacctatttt
gacttgaatgaacaaaagctgttgcatctggctaaattgggacgtcaggtgggggttgac
tgttttgttcttgatgatggctggtttggtacccgtgataatgatttaagttcattgggg
gattggttcacaaataagcataagtttccggatggcttagggcattttgctgaggaaatt
catggcctcggccttcagtttggcctgtggtttgaaccggaaatggtatcgcctcgatcg
caatttttccagaaacatccggattgggtggtccgtcccaagcgcggccgaatgtcgatt
acacgtcatcaatatgttctggattttagtaatccagcggtcgtaaataatatttttgcg
caaatgcaacgcgtcattaccgaaaccaagcttgattatgtgaagtgggatctcaatcgc
agtattaccgaagcctattcaccctacttggcaaaaattgggcatcctcaaggtgaattc
ttccattgctatgtacaaggtgtctataccctctatcaaaagctgctcacggcctttcct
cacctgctgattgaaggctgtgctggtggtggcgggcgctttgatttggggattctcttt
tatagtccgcaaatctggaccagtgatgattctgatgcgatcgaacggttggcaattcaa
tccggaaccgcactggcttatccgttaagttgtatgagcaatcacgtgacggcgataccg
aatgaacaagtcggacgttccacaccgttggctacgcgatttcgtgtggcagcatttggc
attctcggctatgaattggatttgaccaagctggatgatgcggcattggcaacaatcaaa
aaccaaattgcttattatcatgaattacagccattagtcttaaatggtgattttcggttg
cttttgccacgtcaatccaacagccagaatcaagtagcatggctgctaagtgatcattac
cgcaagcgtttagttttaggcttcttccgcgtccttgccgatgcagacagtcgcgccgtg
cagtatatgaagataccggttgcccagccaaaccaacgttattgggtgaacggtcacaca
gggccggtttccggtgatgtcttgcagcgggttggcgttcgcttaccgatccaattcaat
ggcgctaaccggcaacaagcccaattgatcggtgactatcaatcggccttattgactttt
gatggggtaacagcaaccaaaaccggcaagcatcaacctgagattcgcaagcagcagaag
gtcggacatgcttga

DBGET integrated database retrieval system