KEGG   Lactobacillus rhamnosus GG: LGG_01001Help
Entry
LGG_01001         CDS       T00987                                 

Gene name
galA
Definition
alpha-galactosidase (GH36)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lrh00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lrh00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1011649..1013943
Genome map
AA seq 764 aa AA seqDB search
MIDVTDDHAFHLYNQKISYICALLPNGQLGHLYFGPRLSLTTADLTYLSQGSSPFAWMAN
FSDDQPFALGDAQQEYPVYGTGDFRQGSLSVTQADAPVYPNFVFKDYQVSHTKMRNLHHP
TSFGNPALTDVLTIHLEDETAQLLLTLQYTIFSDSATVVRAATLTNQGAEPVMIERMLSG
ALNLPQGRYDVVHLSGNWAKERHIQTQPLTQGTFSVESLRGASSHEQNPFVALHAAGQPF
AVGDAYGANLVYSGNFLDSIEVNEWDQTRLLAGIHPAYFSWRLDPKTSFTTPEVVLSFSS
AGLAGLSQVNQRFVARHIIDPQWRQKPRPVVLNSWEATYFDLNEQKLLHLAKLGRQVGVD
CFVLDDGWFGTRDNDLSSLGDWFTNKHKFPDGLGHFAEEIHGLGLQFGLWFEPEMVSPRS
QFFQKHPDWVVRPKRGRMSITRHQYVLDFSNPAVVNNIFAQMQRVITETKLDYVKWDLNR
SITEAYSPYLAKIGHPQGEFFHCYVQGVYTLYQKLLTAFPHLLIEGCAGGGGRFDLGILF
YSPQIWTSDDSDAIERLAIQSGTALAYPLSCMSNHVTAIPNEQVGRSTPLATRFRVAAFG
ILGYELDLTKLDDAALATIKNQIAYYHELQPLVLNGDFRLLLPRQSNSQNQVAWLLSDHY
RKRLVLGFFRVLADADSRAVQYMKIPVAQPNQRYWVNGHTGPVSGDVLQRVGVRLPIQFN
GANRQQAQLIGDYQSALLTFDGVTATKTGKHQPEIRKQQKVGHA
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgatgttactgacgatcatgcttttcatttatataatcaaaagatcagctatatt
tgtgcgttattgccaaatggtcagttgggccatctctattttggccccagattatcgtta
acgactgctgatttgacctatctatcgcaaggttccagtccgtttgcgtggatggctaac
ttttccgacgatcagccgtttgcattaggtgatgcgcaacaagagtatccagtttatgga
actggcgattttcggcaaggcagtttaagtgtgacccaagcagacgcacccgtgtatccg
aattttgtatttaaagattatcaggtgagtcacaccaagatgcggaatttacatcatcca
acgagctttggtaatccagccctgactgatgttttgacaattcaccttgaagatgaaacg
gcgcagttattattaacgctgcagtatacgattttttcggatagtgccacggtcgttcgg
gcagctactttgacgaaccaaggtgctgagccggttatgattgagcggatgttgagcggg
gcgctgaatttaccccaaggccgttatgatgttgttcacttgtcaggtaactgggccaaa
gagcggcacattcagacacagcctttgacgcaaggaacgttttcagtggaatctttgcgc
ggggcatcgagtcatgaacaaaatccgttcgtcgcattgcacgcagccggacaaccattt
gctgttggcgatgcttacggtgcgaacttagtctattcggggaactttctggatagcatt
gaagttaatgaatgggatcagacgcggcttttggctggcattcatccggcttattttagc
tggcgactagatccgaaaaccagttttactacccctgaagtggtcttaagctttagttca
gcgggactagctggtttatcccaagtcaatcagcgttttgtggcccggcatattattgac
ccgcaatggcgccaaaagccgcgtccggttgttttgaacagttgggaagcgacctatttt
gacttgaatgaacaaaagctgttgcatctggctaaattgggacgtcaggtgggggttgac
tgttttgttcttgatgatggctggtttggtacccgtgataatgatttaagttcattgggg
gattggttcacaaataagcataagtttccggatggcttagggcattttgctgaggaaatt
catggcctcggccttcagtttggcctgtggtttgaaccggaaatggtatcgcctcgatcg
caatttttccagaaacatccggattgggtggtccgtcccaagcgcggccgaatgtcgatt
acacgtcatcaatatgttctggattttagtaatccagcggtcgtaaataatatttttgcg
caaatgcaacgcgtcattaccgaaaccaagcttgattatgtgaagtgggatctcaatcgc
agtattaccgaagcctattcaccctacttggcaaaaattgggcatcctcaaggtgaattc
ttccattgctatgtacaaggtgtctataccctctatcaaaagctgctcacggcctttcct
cacctgctgattgaaggctgtgctggtggtggcgggcgctttgatttggggattctcttt
tatagtccgcaaatctggaccagtgatgattctgatgcgatcgaacggttggcaattcaa
tccggaaccgcactggcttatccgttaagttgtatgagcaatcacgtgacggcgataccg
aatgaacaagtcggacgttccacaccgttggctacgcgatttcgtgtggcagcatttggc
attctcggctatgaattggatttgaccaagctggatgatgcggcattggcaacaatcaaa
aaccaaattgcttattatcatgaattacagccattagtcttaaatggtgattttcggttg
cttttgccacgtcaatccaacagccagaatcaagtagcatggctgctaagtgatcattac
cgcaagcgtttagttttaggcttcttccgcgtccttgccgatgcagacagtcgcgccgtg
cagtatatgaagataccggttgcccagccaaaccaacgttattgggtgaacggtcacaca
gggccggtttccggtgatgtcttgcagcgggttggcgttcgcttaccgatccaattcaat
ggcgctaaccggcaacaagcccaattgatcggtgactatcaatcggccttattgactttt
gatggggtaacagcaaccaaaaccggcaagcatcaacctgagattcgcaagcagcagaag
gtcggacatgcttga

DBGET integrated database retrieval system