KEGG   Lactobacillus rhamnosus GG: LGG_01027Help
Entry
LGG_01027         CDS       T00987                                 

Gene name
res
Definition
type III restriction-modification system restriction subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
lrh  Lactobacillus rhamnosus GG
Brite
Enzymes [BR:lrh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     LGG_01027 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1039970..1042945
Genome map
AA seq 991 aa AA seqDB search
MKIKLETLQHQTDALTAINKAFPGLDTTSNDPNADYIYANPLIKYRYNDKANIDIKMETG
TGKTYVYTRMMYDLHQKYGLFKFVIAVPSPSIKEGTRSFISSDYAKQHFSEFYENTRVQL
NVINAGDFVIRSGRRNFPAQLSEFVEATRQNTNQIEVLLVNQGMLHSKSMHNDDYDQTLL
GGETSPIRAIAATRPVVIIDEPQRFPRGKKFYDDIEDMKPQLIVRFGATFPETTTGRGKN
KVTKVDYFRGEPQFNLNAVDSFNQGLVKGIDIDYPDMSKEQANNLYKVKQVKAKELILFK
DGKDYLLNVGESLADVDSGFEGNITYVGGTDRELSNGLAVSKDMKLIPGTFAKNYQDEIL
SQAIDCHFKAERENFLRLNSGSHTPKIKTLSLFFIDSISSFRGENSSKGWLAKHFEEILK
KKLTKLIDRYELAIDDREKEYRSFLQATLKSLQSEHQDVYAGYFSEDRGSSNADIQAEVE
DILSNKEKLLSFKDEDGNWLTRRFLFSKWTLREGWDNPNVFTIAKLRTSGSEISKIQEVG
RGLRLPVDETGHRLNQDEWQSRLSFLIGYDERDFAQKLVGEINEDSPVKLNKEELTDDMI
KLIVKAKQKTDPKFDEDQLLDDLDRHNVISRSNKFKQDVNLDGEAMTGYDALCRLYPELE
QQTKIAKGKVRDKYSKDSTTVKLRKKNWLQLKNLWLQLAKRQMVKFDPSVNRDAEAVARD
VFNDNDNKIFVLQRPQVVHQEVVTDKNIASVQETQLDYNNEYLTMNYGKFLKGLAKQTDL
PLNLLNNLMIKSIRRLQNNTNYINEKTLENLVRSFNNQFNERIKTSYSYEPLDFAASTSI
YNAEKKEFVNSVPASVLGVYQSNSTSDPTYLYDRPPLRYDSADPELKILQRSYGPKISVF
GKLPKKAIKIPRFDSGTTTPDFIFKIEHGAKPIYLVIETKAENMRLGDEEIRIIQKKYFD
HLKESGVYYRMATSEQEVHDLINKLTNGELD
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaactagaaactttgcaacaccaaactgatgctcttacggccattaataag
gctttcccaggcttagataccacgagcaatgatccaaatgctgactatatctatgccaat
cctttgattaaatatcggtataacgataaagcaaatatcgacattaagatggagactgga
actggtaaaacctatgtttacactagaatgatgtatgaccttcaccaaaagtatggattg
tttaagtttgttattgctgtgcctagtcccagcattaaggaaggtacacgtagttttata
agtagtgattacgcaaaacagcatttcagcgaattttatgagaatacccgagttcagcta
aatgtgattaacgcgggtgattttgttatacgttcggggcgacgcaacttccctgctcaa
ctatctgaatttgtggaagcaaccaggcaaaatactaaccaaattgaagtattgctggtt
aaccaagggatgttgcattccaagtccatgcacaatgatgactacgaccaaactttatta
ggaggtgaaacatctcctattagggctattgctgcaactcgaccagtagtgatcattgat
gaaccacaacgctttccacgaggcaagaagttttatgacgatattgaagatatgaagccg
caattaattgtacgtttcggtgctacctttccagaaaccacaaccggtcgcggtaaaaac
aaagtcaccaaagtcgattattttcgaggcgagccacaatttaacctcaatgccgtagat
agttttaaccaaggcttggttaaaggaatcgatattgattatcctgatatgtcgaaagag
caagccaataacttgtacaaggttaaacaagttaaggctaaagaattaattctgttcaaa
gatggcaaggactacttattaaatgtaggtgaaagcttggctgatgtggactctggtttt
gaaggcaatatcacctatgtcggtggaactgatcgtgaactttccaatggtcttgccgta
tcaaaagatatgaaactgatccctgggacttttgcaaaaaattaccaggatgaaatactc
tcccaagcaatcgattgtcactttaaggctgaaagggaaaactttttgcgcttgaattcg
ggaagtcacacgccaaagattaagaccctttccctattctttattgatagtatttctagt
ttccgtggcgaaaacagcagcaaaggctggctagcaaagcactttgaggaaattctaaag
aaaaaactcacaaaactaattgatcgatacgaattggccattgatgatcgcgaaaaagaa
tatcgttctttcttgcaggccaccctaaagagcctgcaatcagaacatcaagacgtttat
gctggttactttagtgaagaccgaggtagctcgaacgcagatatccaggccgaagttgaa
gatattttaagcaacaaggaaaaactacttagttttaaagacgaagacggtaactggtta
acccggcgtttcctcttttctaagtggaccttacgtgaaggttgggataatccaaatgtt
tttacgattgctaaattacgaacttcgggttctgagattagtaagattcaggaagttggc
cgtggcttgcggctgccggtagatgaaacggggcatcgcttaaatcaggatgaatggcag
agccgactgtccttcttgattggttatgatgaacgggatttcgctcagaaattggtgggt
gaaatcaatgaagattccccagtgaagttgaacaaagaagagttgactgatgacatgatc
aagttaatcgttaaagctaaacagaaaacagatcctaagtttgatgaggatcagctgctt
gatgatttagatagacataatgtgattagtcgttctaataagtttaaacaagatgttaat
ctcgatggtgaggccatgactggctatgatgcattatgccgcctctacccagaattagaa
caacaaacgaaaattgctaagggcaaggttcgagataagtattctaaagatagcacaact
gttaaattgcggaagaaaaattggttacagttgaagaacctctggttacaacttgctaaa
cgacaaatggttaagtttgatccctcagttaatcgggatgccgaagctgttgcacgcgat
gtctttaatgataatgacaataaaatctttgttttgcaacgtcctcaagtggtgcaccaa
gaggttgtcactgataaaaacattgcttcagttcaagaaactcagttagattataataat
gaatatctaacgatgaattatggtaagtttctcaagggcttagctaagcagactgatttg
cctcttaaccttctcaataacctgatgattaagtctatcaggcgcctgcaaaacaacact
aactatattaatgaaaagacgttagaaaaccttgttcgcagctttaacaatcagtttaac
gaaagaattaagacctcttatagttatgaaccactagactttgcagcatctacatccatt
tataatgctgagaagaaagagtttgttaactcagtgcctgctagtgtacttggcgtttat
caatctaattcaacttctgatcctacttatttatatgatcgcccaccgcttcgttatgat
agtgccgatccagaattaaagattttgcaacgctcatatggtccgaagatcagtgtgttc
ggtaaattacccaagaaggccatcaagatccctcgctttgacagtggaacgacgacacct
gactttatctttaagattgagcatggtgctaaaccaatctatctggtaattgaaacaaaa
gctgaaaatatgcgcttgggtgatgaagagatccgtattatccaaaaaaagtactttgat
caccttaaagagtcaggtgtttactatcgaatggctacgagtgaacaggaggttcatgac
ttaatcaataaattgacaaacggggagttggactag

DBGET integrated database retrieval system