KEGG   Lactobacillus rhamnosus GG: LGG_01062Help
Entry
LGG_01062         CDS       T00987                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LGG_01062 (galU)
   00052 Galactose metabolism
    LGG_01062 (galU)
   00500 Starch and sucrose metabolism
    LGG_01062 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LGG_01062 (galU)
Enzymes [BR:lrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LGG_01062 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074439..1075359
Genome map
AA seq 306 aa AA seqDB search
MSVKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGK
QKRSIEDHFDSAPELEQNLKEKHKDALLQLVHSTTDIGVNLFFVRQPYPRGLGDAVRLAK
SFVGDEPFVVMLGDDLMNDKVPLTKQLIDEYDKTHASILAVKKVPHDEVSAYGVIDPEKE
VSKDLYNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILDNQKPGKGNEIQLTDAIDTL
NQTQRVFAHEFKGDRYDVGNKFGYVKTNVEYGLTHPEVKDELRAYILDLAAKLQSGNPVG
KPANKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaagttcgcaaagcagtgataccggcagccgggcttgggacccgttttctg
ccagcaaccaaagctttagctaaggaaatgttgccgattgtcgacaaaccgaccattcaa
tttatcgttgaagaagctaaggccagtgggattgaggatattctgattgttgagggtaaa
caaaaacgctctattgaagatcattttgactcagcacctgagctggaacagaatctgaaa
gaaaaacataaagacgccttgctacagctggttcattccacaaccgacatcggcgtcaac
ttattcttcgtgcggcagccatatccgcgtggtcttggtgatgccgttcgcttagccaaa
tcgtttgttggcgatgagccattcgtggtcatgttgggtgatgacctgatgaatgacaaa
gtgccgttgaccaagcaattaatcgatgaatacgataagacccatgcgtccattcttgcc
gttaaaaaggtgccgcatgatgaagtatcggcatatggcgttattgatccggaaaaagaa
gtttccaaagacctctataacgttaagaaatttgttgaaaagccagccgttgctgatgcc
ccaagtgacttggcaatcatcggccgctacctgctgaccccggaaatttttgatattctt
gataatcaaaaaccaggcaaaggcaatgaaattcagttaaccgatgcgatcgatactttg
aaccaaactcagcgcgtctttgcacatgagtttaaaggtgatcgctatgatgttggtaat
aagttcggatacgtcaagaccaatgttgaatatggtttgacccatccggaagtaaaagat
gaactccgcgcgtacatccttgatctggctgctaagttgcagtcaggcaatcctgtgggg
aagccggcaaataagaaatag

DBGET integrated database retrieval system