KEGG   Lactobacillus rhamnosus GG: LGG_01374Help
Entry
LGG_01374         CDS       T00987                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh00010  Glycolysis / Gluconeogenesis
lrh00030  Pentose phosphate pathway
lrh00051  Fructose and mannose metabolism
lrh00052  Galactose metabolism
lrh00680  Methane metabolism
lrh01100  Metabolic pathways
lrh01110  Biosynthesis of secondary metabolites
lrh01120  Microbial metabolism in diverse environments
lrh01130  Biosynthesis of antibiotics
lrh01200  Carbon metabolism
lrh01230  Biosynthesis of amino acids
lrh03018  RNA degradation
Module
lrh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGG_01374 (pfkA)
   00030 Pentose phosphate pathway
    LGG_01374 (pfkA)
   00051 Fructose and mannose metabolism
    LGG_01374 (pfkA)
   00052 Galactose metabolism
    LGG_01374 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LGG_01374 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LGG_01374 (pfkA)
Enzymes [BR:lrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LGG_01374 (pfkA)
Protein phosphatases and associated proteins [BR:lrh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LGG_01374 (pfkA)
Messenger RNA biogenesis [BR:lrh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LGG_01374 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CAR87269
Position
1377282..1378241
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMSESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAYGDF
QLRATVLGHIVRGGAPSARDRVLASQMGAYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggtgatgctccaggcatgaacgccgcggtt
cgagccgttgctcgcaaggcgatgcatgaaggccttgaagtatatggcatcaattatggc
tttgccggtttagtggccggtgacatttttaaaatgagcgagtcaacggttggtgacaag
atccaacgtggcggtaccatgctgtactccgcccgttatccgcagtttgctcaagaagaa
ggccaattgcgcggggttgaacagcttaacaagttcggtattgaagcactggttgttatt
ggcggcgatggttcataccacggtgcattggcactaacccgtcacggtttcaatacaatc
ggcttacccggcacgattgataatgatattccgtacactgatttcacgatcggatttgat
acggcggttaataccgtggttgaagcggtggatcggttgcgggatacggctgcatcccat
gaacggacctttgtcattgaggttatgggacgtgaagcaggcgacatcgcattgtggtct
ggcgttgccggcggggccgaagatgtcattatccccgaacacgacttcgatgttaaaaag
attgcttcgaagttacaaagttcccgtgaacgtggtcaaaagcatgcggttatcttgctg
gctgaaggcgtgatgcacgccgatcagtttgccaaggaacttgctgcctatggtgatttc
cagttacgtgctaccgttttaggtcatatcgttcgtggtggtgcgccatcagcacgtgac
cgcgtattggcttcccaaatgggtgcttacgccgttgaactcttgctgcaaggcaagggt
gcgttggcagtcggcattgaaaataacaaaattacggcgcatgatgtccggactttgttt
gatgccaagcaccacgccgaactttcgctctacaccttggcggaagagttaacattttaa

DBGET integrated database retrieval system