KEGG   Lactobacillus rhamnosus GG: LGG_01398Help
Entry
LGG_01398         CDS       T00987                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lrh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lrh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401111..1401602
Genome map
AA seq 163 aa AA seqDB search
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAPGAVVVHDVAAVFAYAKQHPDQELVIAGGAQVFTAFRDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatttttatgggcacaggatcgcgatggcttaattggcaaagatggtcatttg
ccatggcatttacctgatgatttacattatttccgggcgcagacagttggtaagatcatg
gtcgttggtcggcgcacctatgaaagttttcctaaacgtcctttacctgagcgaaccaat
gttgttttgactcatcaggaagactatcaagcgccaggtgccgtggtcgtgcatgatgtt
gcggcggtttttgcttatgctaagcagcatcccgatcaggaactggtcattgctggtggt
gcgcaggtctttacggcgtttagagatgatgtcgatacgttactggtgacacggttggct
ggcagttttgaaggcgacacgaaaatgattccattaaactgggatgattttaccaaagtc
tccagccgcaccgttgaagataccaatccggcgctgacgcacacttatgaggtttggcaa
aagaaggcttaa

DBGET integrated database retrieval system