KEGG   Lactobacillus rhamnosus GG: LGG_01443Help
Entry
LGG_01443         CDS       T00987                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lrh01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lrh00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1446192..1447472)
Genome map
AA seq 426 aa AA seqDB search
MKILTGTLTELQQQVTTRQQTVAQNPAVQTTVQKILADVKLNGDKALLAYNATFDDVAIS
DLRVPQAQINAAMADLSPKLLAALTLAKKNITSFHQLEMSQGFIDSPYPGVIRGQKLTPL
AAVGLYVPGGTAAYPSTILMTAIPAKLAGVKKIVMVTPPQAKGLNPAVLAAAKLAGVDEI
YQVGGAQAIGALTYGTESIPKVDKILGPGNRYVAEAKKQVFGDVAIDMIAGPSEIGIIAD
DSADPVRVAADLLSQAEHDPNARAMLVTTSPALADAVSKAVDSQLLSLPRKAIAQAAITN
QGFIAIVPDVASAFCLMNTIAPEHLEIQLPNPITYLNEIHNAGSVFLGENAAEPVGDYVA
GPNHVFPTAGSARFFSPLGVYDFVKRTQFIQYSAAALATQADAIVTLAQTEGLDGHAEAI
LKRITR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttaccggtaccttaaccgagcttcaacaacaagtgaccacccgccagcaa
accgttgcccagaatccggcagtgcagaccaccgtccaaaaaattctggcagacgtcaaa
ctaaatggggacaaggctttacttgcctacaatgccacttttgatgatgttgctatctcc
gacctccgcgtaccacaagcgcaaatcaatgccgcaatggctgatctctcgccaaaatta
ctggcagcattaacccttgccaaaaaaaacatcaccagttttcaccagctagaaatgagc
caaggctttattgatagcccatatcccggtgttatccgtggtcaaaaactaacgccacta
gccgcggtaggtttgtatgtcccaggcggcaccgcggcttatccctccacgattctgatg
accgcaattccggctaaactcgcaggggtcaagaaaatcgtcatggtaacgccgccacaa
gcaaaaggtttaaatccagctgtattggcggccgcaaaactagcaggggtggacgaaatt
tatcaggttggcggtgcccaagcgattggcgcattgacttatggcactgaaagtattccc
aaagtcgataaaattttaggccccggaaatcgctacgttgctgaagctaaaaaacaggtt
tttggcgatgttgcgattgatatgatcgctggcccatccgaaatcggcattattgctgat
gattcagcagatccggtacgggtggcagctgaccttttgtcacaagcagagcacgatcca
aacgcgcgcgcaatgttggtgacgactagtccagcgctggcagatgccgtcagtaaggcg
gttgactcacaactgctaagtttgccgcgtaaggcgattgcacaagcagcgatcaccaac
caaggttttatcgcgattgttcctgacgtagcttctgcattttgcttaatgaataccatc
gccccggaacatttggaaattcaattacccaatccaatcacttatctcaatgaaattcac
aatgccggttccgttttcttaggtgaaaatgccgccgaaccagttggcgattatgttgcc
gggccaaatcatgtttttccaacagccggatcggcacgatttttctcaccactgggcgtt
tatgacttcgtgaagcgtactcaattcattcaatatagtgccgcggcattggcaactcaa
gcagatgcaattgtgacgctggcacaaactgaaggactggatgggcatgcggaggcgatt
ttgaaacggattacgcgttag

DBGET integrated database retrieval system