KEGG   Lactobacillus rhamnosus GG: LGG_01703Help
Entry
LGG_01703         CDS       T00987                                 

Gene name
gki
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGG_01703 (gki)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGG_01703 (gki)
   00052 Galactose metabolism
    LGG_01703 (gki)
   00500 Starch and sucrose metabolism
    LGG_01703 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    LGG_01703 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LGG_01703 (gki)
   00524 Butirosin and neomycin biosynthesis
    LGG_01703 (gki)
Enzymes [BR:lrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LGG_01703 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1728141..1729103)
Genome map
AA seq 320 aa AA seqDB search
MNDQKLIGVDLGGTTVKFAILTQDGEIQQRWSIDTNILDEGSHILPDIVTSINEHLDLYK
MTPADFVGIGMGSPGSVDSEAGTIIGAYNLNWKTLQQARKIIESGTGIPFSVDNDANVAA
LGERWKGAGENDPDVTFVTLGTGVGGGIIANGELLHGVAGSGGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKETLDDGDEISSKIVFDLAKEGDRLALM
IVDRVSFYLGLALANVGNLLNPKFIVIGGGVSAAGEFLLTRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccaaaaattgattggcgtcgacttaggcgggacgaccgtaaaatttgccatt
ttaacgcaggatggcgagattcaacaaaggtggagtattgacaccaatattttggatgaa
ggcagccatattttaccggacattgttacatctattaatgaacatctggatttatacaag
atgaccccggctgattttgtcggtattggcatgggttcgcctggatcagtggacagtgag
gcgggcacaattatcggtgcttacaacctaaactggaaaaccttgcagcaagccagaaaa
ataatcgaatcagggaccggcattccgtttagcgtggataatgacgccaatgttgcggcg
ttaggtgagcgctggaaaggcgccggtgaaaacgatcctgatgtcacgtttgtcacgctg
ggtaccggtgttggtggcgggattattgccaatggcgagctcttgcatggtgttgccggt
tccggtggtgagctaggccatgttaccgttgatccggttaatggctatctttgcacctgt
ggtaaacgtggttgccttgaaacagttgccagtgcgaccggtgtagttcgagttgcgcgt
gacatggcagaagaatttgccggcgactctaagttaaaagaaaccttggacgatggcgat
gagatttcgagcaaaattgttttcgacttggccaaggaaggcgatcgtctggcgttgatg
attgtggatcgggtttctttttacctcggtttggctttggccaatgtcggcaatcttttg
aatccgaaattcatcgttatcggcggcggtgtctccgcggccggtgaattcttgctgacg
cgagtcgacaagtacttcaaagaaaacaccttcccgaatgttcgtgaaactactagtttg
cggttggcgacactggggaatacagctggcgttatcggtgctgcaagcttggcactgaag
taa

DBGET integrated database retrieval system