KEGG   Lactobacillus rhamnosus GG: LGG_01718Help
Entry
LGG_01718         CDS       T00987                                 

Gene name
pheS
Definition
phenylalanyl-tRNA synthetase subunit alpha
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lrh00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1745338..1746384)
Genome map
AA seq 348 aa AA seqDB search
MDLQTKLEQLFQQNNEVIKKITSLDELNQIRVQLLGKKGPITSVLRGMKDLSADERPKVG
AFANKVRDELSTVIETRKSQLEQAVINEKLKSETVDVTLPGDPVTAGTPHIIIQIMDDLE
SFFMGMGYQVLTGPEVEEDHYNFEMMNIPKDHPARDMQETFYITNELLMRSQTSPMQART
MEKHDFTKGPLKMISPGVVYRRDDDDATHSHQFHQMEGLVIDKHITMADLKGTLLAMCQH
VFGADRTIRLRPSYFPFTEPSVEVDVSCFRCGGKGCPVCKYTGWIEVLGAGMVHPNVLRA
ANIDADVYGGFAFGLGPDRFAMLKYGIDDIRSFYTDDLRFLTQFSQEG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggatcttcaaacgaaacttgaacaactttttcagcaaaataatgaggtgataaaaaag
atcacctcgttggacgaattaaatcagattcgcgtccagttgttggggaaaaaaggcccc
atcaccagcgttttgcgcggcatgaaggatttatcagcagatgaacggccaaaagtcggt
gcctttgccaataaagtccgggatgaactgagtacggtgattgagacgcgtaaatctcaa
ctggagcaggcagtcatcaacgaaaaattgaagtctgaaaccgtggacgtcacattacca
ggcgatccggtaacggcgggcacaccacatattattattcagattatggatgaccttgaa
agcttctttatgggcatgggctatcaagtgctaaccggtccggaagtggaagaggatcat
tacaactttgaaatgatgaacatccccaaggaccatccggcgcgggatatgcaggaaact
ttttatattaccaatgagttgctgatgcggtcccaaaccagcccgatgcaggcgcggacg
atggagaaacatgactttactaagggcccgctgaaaatgatcagtccaggcgtggtttat
cggcgtgatgatgatgatgccacacatagccaccagttccatcagatggaaggcctggtg
atcgacaagcatattacaatggctgatcttaaggggacgttactcgccatgtgtcagcat
gtgtttggcgctgatcggacgattcgcctgcgcccgagctattttccgtttacagaaccg
tctgtagaagtggacgtttcctgcttccgctgcggtggcaagggctgccctgtttgcaag
tataccggctggattgaagttctcggtgccggcatggtgcatccgaatgttttacgtgcg
gctaatattgacgccgatgtatatggcgggtttgcatttggtcttggcccggatcggttt
gccatgctgaaatacggcattgacgatattcgcagtttttacacagacgacttgcgcttc
cttacgcagttcagtcaggagggttaa

DBGET integrated database retrieval system