KEGG   Lactobacillus rhamnosus GG: LGG_02032Help
Entry
LGG_02032         CDS       T00987                                 

Gene name
fbp
Definition
(GenBank) Fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh00010  Glycolysis / Gluconeogenesis
lrh00030  Pentose phosphate pathway
lrh00051  Fructose and mannose metabolism
lrh00680  Methane metabolism
lrh01100  Metabolic pathways
lrh01110  Biosynthesis of secondary metabolites
lrh01120  Microbial metabolism in diverse environments
lrh01130  Biosynthesis of antibiotics
lrh01200  Carbon metabolism
Module
lrh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGG_02032 (fbp)
   00030 Pentose phosphate pathway
    LGG_02032 (fbp)
   00051 Fructose and mannose metabolism
    LGG_02032 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LGG_02032 (fbp)
Enzymes [BR:lrh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LGG_02032 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: CAR87927
Position
complement(2081384..2083315)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTETTLQRFAFLVYYPSERLTAIHQELQGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADEWIEATCR
TIQRLTVDHFHIVGDIYDRGPAPDQVVESLIKRDQRHSVDIQWGNHDILWIGGAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNPAFSPKMGRSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPAIKRRPEFEMDHRLLLDKLAADFSTIQLNGHTYPITNGCFAT
VDPADPYRLLPEEQEVIDSLVESFTHSEKLHRHMDFLMDRGSMYLRYNRNLLLHGCVPVD
EDGNFIGLTIEGTTYTGRQLFDMLEANLRLAYSQPTEKADLATDLLWYLWTGPNSPLFGK
HDMTTFERYFIKDPATHAEGRNAYYHLRKDPDFIKKILREFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAIANLTDI
ISTRRVVETEARRRTVAETDIGTALQAEVEVLKRRLAELRNGD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtacagtgaattgacggccaagtatcaaacggttccggccattgccaccgag
atcatcaacttggaggcgattttgaacctgcccaagccaacagaggcgtttatgagcgat
attcacggggaatataatgcgtttcagcatgttctgcgcaatggcagcggtaatgtgaag
agcaagatacgttcatgttttcgggatgagatgaccgagacgactttgcagcggtttgct
tttttggtgtattacccgtcggaacggttgactgcgattcatcaggagctgcaaggggat
gatttgcagcagtggtatctgaccacttttcgccggttgattcgcttgctggcgtttacc
gcgactaaatatacccgttcgaaagtgcgtaaggcgatggcgccggagtttgtttatatt
accgaagagctgctgtataacgatgcggacacgcctgataagctggcttattattggcag
attattcgcaacttgattgttttggagcaggccgatgagtggattgaggcgacgtgtcgg
acaattcagcggctgacggtcgatcattttcacattgtgggtgatatttatgatcggggg
ccggcgccggatcaggtggttgagagtttgatcaagcgtgatcagcgacattcggtggat
attcagtggggcaatcatgatattttatggatcggcggtgcagctggttcggcgttgtgt
attgccaatctggtgcggatttcagcccggtacaacaacctgagcattcttgaagatgtt
tatgggattaatttgcgccatttagcacgcttggcggaacaatattatcaggataatccg
gccttttcgcctaaaatggggcgctcggatcggccaattaccgaggcggaacggttacaa
atcacccagattcatcaggcaattgccatgattcagttcaaacttgaaggcccggccatc
aagcggcgtcctgaatttgaaatggatcatcggttattgctggacaagttagccgcggat
ttttccacgattcagttgaatgggcatacttatcccatcaccaatggctgttttgcgacg
gttgacccggctgatccttaccgactgttgccggaagagcaggaggtcattgattcctta
gtcgagtcgttcacccattcggaaaagttgcatcgccatatggattttttgatggatcgc
ggcagtatgtatctgcggtataatcgcaatttgctgttacacgggtgcgtgccggttgat
gaagatggcaatttcattggtttaacgattgaaggcacgacttatacaggccggcagttg
tttgacatgctggaagccaatttgcgcctcgcctacagtcagcccacggaaaaagcagac
ttggcgactgatttgctatggtatctgtggaccggtccgaattcgccgctttttggcaag
cacgacatgaccacatttgagcggtactttatcaaggatcccgcgacgcatgcagaaggc
cgtaatgcttattatcacttgcgcaaggatcctgatttcatcaaaaaaattctgcgtgag
tttgtgcttgatccggaagtcggtcacgtgattaatggtcatacgccggttaaaaaagga
accgatccaatcatggcgaataacaaaatgattgtcattgacggcggattttcaaagcct
taccaaaagacaaccggtattggcgggtatactttgttggataattcgtatggcatgcag
ctggtcacccatcagccgtttacaaccaaggccgatgcgattgccaatttaaccgacatt
atttccacgcgccgagttgttgaaacggaggcacggcgccgcaccgtggcagaaaccgat
attggcaccgcgctacaggctgaggtggaggtgttaaaacggcgccttgctgagttacgc
aatggtgactaa

DBGET integrated database retrieval system