KEGG   Lactobacillus rhamnosus GG: LGG_02082Help
Entry
LGG_02082         CDS       T00987                                 

Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lrh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2134581..2137160)
Genome map
AA seq 859 aa AA seqDB search
MPQTQVYENVDLQIIKLLFNSDSSDYKVYAVRILNPNPALKMTLTQEATVTGDMGYYNRR
AIITADLVYDDADSLRYRKPSYKVARLHFGLPKEPRRQWQLLETLLVHQPTVLRRLHEAF
ADDEPILATFSKTTIKDARIPGIGPATIQKIATAIRGKLEVAVLANHWRKALSSMTYEKI
WLAYKDAELAMHHIDANPYLLMQVAQFDFKKADAFAKSLGVAANDPHRLAAGLQYIFRTA
VLTQGLTYITITWFKQQAATLLGVRAEDLTMFADPKQALAYGFLLNEQYDLVTSCDMFAT
EGSVAKIMTVAQKTAEPLIKPEELDDKLDQFLDRHQLVINDQQRAAFQNVNQHGLSVLNG
SAGTGKTWLTNLLVHFFNAQAKGKSVLLAPTGRAAKVLAKYTHEPAATIHAYLHLLPGEE
LERFNAESDWETFGDARLIIVDESSMLTTPLAYTVLKHVNFKKAHMLFVGDVFQLPPIGP
GNFLKDCLADSQVAATTLTRVYRQDAQSGVLALANRIRDRLPLPFGPDDDRYVSGNVALY
NQRDAGRVFDAGIKAYQDALAKSGHELDSQLLIVNKNVGATGRLRFNAELQALVNPTRPG
EEEYVSSYVDPVTKQKHHLRMRDRVMILKNDKHVALVDPKTWERRAVLGENGLQQTDEFG
TKRWRETIMANGDTGVIAHIDTKRRFLVVQVGQQYCYYSFGSVPRALTLAYAITVHKAQG
GQADTVIAIVNGADHMLNAQSFYTALTRTQARFIFFGDFRVLLARTQIYPMDTRHDLLGS
LLSGQLTVDNFSRFTFEQILAWLDHQQRQGNQPRAALEAEKPDATSQPFSVRYAEQLDIL
NQVVETVAKLPVRKSSEEH
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
gtgccacagactcaggtttatgaaaatgttgacctacagattattaagttgttgttcaac
agtgatagcagcgattataaagtttacgcggtgcggattttgaacccgaatccggcgctc
aagatgacgctcacacaagaagccacagtgaccggcgacatgggttattacaatcggcgc
gccattatcactgctgatttggtttatgatgatgccgattcactgcgctatcggaaaccg
tcttataaagtggcgcggctgcattttggcttaccgaaagaaccccgccgtcagtggcag
ttgcttgaaaccttgctcgtgcaccagcccacggttttacgccgcttacatgaagcgttt
gccgacgacgagccgattttggcgactttttcaaagaccacgattaaggatgcgcggatt
ccggggatcgggccggcgacgatccaaaaaattgccacggccattcgcggtaaacttgag
gtcgcggtgctggccaatcactggcgtaaagcgcttagttcgatgacgtatgagaaaatc
tggctggcgtataaagatgctgagttggccatgcaccatattgatgccaatccgtatttg
ctgatgcaagtggcgcagtttgatttcaagaaggcggatgcgtttgctaaaagtcttggg
gttgcggccaatgatccgcatcgccttgctgcgggattgcagtatattttccggacggcg
gttttgacgcaagggttgacctacattacgatcacgtggtttaagcaacaggcagccacg
ttattaggggtgcgcgccgaagacctgacgatgtttgccgatcctaaacaggcgttggcg
tatggctttttgttaaatgaacagtatgacttggtgaccagctgcgatatgtttgccacg
gaaggctcagtggccaaaataatgacggtggcacagaaaaccgcagagccactgattaag
ccggaagaactggatgacaaactggatcaatttttggatcgccatcagctcgtcatcaac
gaccaacagcgcgctgcttttcagaatgtgaatcagcatgggctaagtgtgctgaatggc
agtgcgggcaccggtaagacttggttgaccaatttgctggttcactttttcaatgcccag
gcgaaggggaaaagtgtgttgctggcaccaaccgggcgggccgcgaaggtgttggcgaag
tatacgcacgaacctgccgccacgattcacgcgtacttgcacttgctgccaggcgaggag
cttgagcggttcaatgcggagtcggattgggagacatttggtgatgcgcggttgatcatt
gtcgatgaaagctcgatgttaaccacgcccttggcctataccgtgttgaaacacgtgaat
ttcaaaaaggcacacatgttgtttgtcggcgatgtctttcagctgccgccaattggtccg
ggtaactttttgaaggattgtttagccgattcgcaggtggcggccacaactttgacgcgg
gtttatcgtcaggatgcgcaatcaggggtgctggcgctggccaatcgaattcgggatcgg
ctgccattaccattcggaccggatgatgatcgctatgtcagcggtaatgtggcgctttac
aatcagcgcgatgccggccgcgttttcgatgccggaatcaaggcgtatcaagacgcgcta
gccaaaagcggccacgagctggactcgcaacttttaattgtgaataaaaatgtgggcgcc
actggtcgactgcgatttaatgccgaactgcaggccttggtcaatccgaccaggcctggt
gaggaagaatacgtcagcagttatgtcgatccggtgaccaagcaaaagcaccatttgcga
atgcgtgatcgcgtcatgattttaaaaaatgacaagcatgtggcgctggttgatcctaag
acttgggagcggcgtgcagttttaggcgaaaatgggttgcagcaaaccgacgaattcggg
acaaagcgttggcgggagacgattatggccaacggtgatactggggtgattgcccatatt
gataccaagcggcgatttctggttgtccaagttggccagcaatattgttattacagcttt
ggcagcgtgccgcgggcgttgacgttggcgtatgcgatcacggtccacaaagcgcaaggc
ggtcaggcggatacggtgatcgccattgttaatggggccgatcatatgttaaatgcccag
agcttttataccgcgttgacgcgaacgcaagcacgctttatcttttttggcgactttcgg
gtgttgctggcgcggacgcagatttatcccatggacacccgccacgacttactcggcagc
ctgctatcgggacaattgacggtggataacttcagccgcttcacatttgaacagatactg
gcgtggttggatcatcagcaacgccaaggtaaccaaccgcgcgcggcactggaggcagaa
aagcctgatgccaccagccaaccattttcggtgcgttatgctgagcagctggatattttg
aatcaagttgttgagacggtggccaagttgccggttcgtaaatcgtctgaggaacattga

DBGET integrated database retrieval system