KEGG   Lactobacillus rhamnosus GG: LGG_02138Help
Entry
LGG_02138         CDS       T00987                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGG_02138 (gpmA)
   01230 Biosynthesis of amino acids
    LGG_02138 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGG_02138 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LGG_02138 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGG_02138 (gpmA)
Enzymes [BR:lrh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LGG_02138 (gpmA)
Exosome [BR:lrh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LGG_02138 (gpmA)
  Exosomal proteins of melanoma cells
   LGG_02138 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2205749..2206438)
Genome map
AA seq 229 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKHAGELIKQAGLEFDQAYTSVLTR
AIKTLHYVLEESGQLWIPEMKTWRLNERHYGALQGLNKKETADKYGADQVHIWRRSYDVL
PPLLKATDEGSAAKDRRYADLDPRIIPGGENLKVTLERVIPFWEDHIAPDLLDGKNVVIA
AHGNSLRALTKYIENISDADIMNLEMATGEPVVYDFDEKLNVNSKTKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattgatccgtcacggacaaagtgaatggaacctgtccaaccagttc
actggctgggtagatgttgatctgagtgaaaagggtgtcgaagaagcaaagcatgccggt
gaattaattaagcaggctggtcttgaattcgaccaagcttacacctcagttttgacccgt
gcgatcaagaccctgcactacgtcttggaagaatccggccaattgtggattccagaaatg
aaaacctggcgcctaaacgaacgtcactatggcgcattgcaaggtttgaacaagaaggaa
acggctgacaaatacggtgccgatcaagttcacatctggcgccgttcgtacgacgttttg
ccaccattgttgaaggcaactgacgaaggctctgctgctaaggatcgtcgttatgccgac
cttgatccgcggatcattcctggcggcgaaaacctgaaagtgacgctggaacgggttatc
ccattctgggaagaccacatcgcaccagatctgttggacggcaagaatgttgttattgcc
gcacatggtaactctctgcgtgccttgaccaagtacatcgaaaacatttccgatgctgac
atcatgaacttggaaatggcaactggcgaaccggttgtttatgactttgatgaaaagttg
aacgttaacagcaagaccaagttggactaa

DBGET integrated database retrieval system