KEGG   Lactobacillus rhamnosus GG: LGG_02154Help
Entry
LGG_02154         CDS       T00987                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGG_02154 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGG_02154 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LGG_02154 (thrC)
Enzymes [BR:lrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LGG_02154 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2221223..2222737)
Genome map
AA seq 504 aa AA seqDB search
MRYTSTRDQRVSKTGQQAIKQGISEEGGLFVLPHLTDYRLNLQNLLGKDYETIAQNVLTT
LLPDFNTAALKKAIQFAYHKNFSDRRLTPVRSVGDFHVLELFHGPTSAFKDLGLQLLPQL
MRLALDPEDRIMILAATSGDTGTAALQGFKNVAQTGITVFYPDHGVSPIQERQMLTTTGN
NTRVFPIGGNFDQAQSAVKDLFTDTGFAARLQAEQVTLSAANSINIGRLIPQVVYYFSAY
LQLVESGAIELGQKVNFTVPTGNFGDVLAGFYAKLMGLPIHQLIAAANANHELADFLETG
IYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSSYVAKLMEELATTGRYQVRPDVLA
AIQADFAGGFAADAQIAASIAAVWKQNDYLLDPHTAVGYHVMQQYRETTGDSTPNVLLAT
ASPYKFPRAVAQALDLPVTGDDFAVMTQLHQMSGVPIPANLARLATLTAQPKHVVAPEEM
GQAIIAAAKEVFNNDQRVRSGNKR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacacaagtacacgggatcagcgcgttagcaagactggacaacaagcgatcaag
caaggcatctccgaagaaggcgggttatttgttttaccgcatctaacggattaccgcttg
aatcttcaaaatttattaggtaaagattatgaaacgattgctcagaatgttctcacgacc
ctgttgcctgattttaacactgctgcgttgaaaaaggcgatccaatttgcctatcataaa
aatttttctgatcgccggctgacgcctgttcggtctgtgggtgattttcatgttttagag
ctgtttcatggcccaaccagcgcctttaaagacttggggttgcaactactaccgcaactg
atgcgcctggcactggatccggaagatcgcatcatgatcttagccgcaaccagtggcgat
accgggactgcggcgttgcaagggttcaaaaatgtcgcccaaaccgggattaccgtcttt
tatcctgatcatggggttagtccgattcaggagcggcaaatgttaacgacaaccggcaat
aacacacgggttttcccaattggcggtaactttgatcaagcgcagagtgccgttaaagat
ctctttaccgacaccggttttgcggcgcgtttgcaggcggaacaagtaacgctttcggcc
gccaattcgattaatatcgggcgtttgattcctcaggtggtttattatttttccgcctac
ttgcaactggttgaatcaggtgccattgagcttggtcaaaaggttaatttcactgttcca
actggcaactttggggatgtcctagctggtttctatgcgaagttaatggggttgccgatt
catcaactaattgccgcggccaacgccaaccatgaactggcggactttcttgaaaccggt
atttatgatcgcaatcgtccgttcctaaagacggtggcgccaagtatggatattcagatt
tccagtaacttggaacggctactctactataagagtggtgaagatagcagttatgtggct
aaattaatggaagaattggccacaaccggccgctatcaggtacggcccgatgttttggca
gcgattcaggctgattttgctggcggttttgccgcagatgcacagattgcagcttcaatt
gctgcggtttggaagcaaaacgactatttgttggatcctcacacggctgtcggctaccat
gtgatgcagcaatatcgggagacaaccggtgattcgacccctaatgtgctactcgcaacg
gctagtccatacaaatttccacgcgcggttgctcaagcccttgacttgccggtgacaggt
gacgactttgctgtgatgacccagttgcatcaaatgagtggtgttccgattcctgctaat
ctagcgcgcttggcaactttgactgcccaacctaaacacgtggtggcgccggaagaaatg
ggccaggcgatcattgcagccgcaaaggaggtttttaacaatgatcagcgtgtccgttcc
ggcaacaagcgctaa

DBGET integrated database retrieval system