KEGG   Lactobacillus rhamnosus GG: LGG_02276Help
Entry
LGG_02276         CDS       T00987                                 

Gene name
rplL
Definition
50S ribosomal protein L7/L12
Orthology
K02935  
large subunit ribosomal protein L7/L12
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:lrh03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2345790..2346158)
Genome map
AA seq 122 aa AA seqDB search
MALDVDGIIAQLKDASILELNDLVKSIEDEFGVKAAAPVAAGGAAGGDAAATKDTYDVEL
TEAGQEKVKVIKAVREITGQGLKDAKGLVDAAPKVIKEGLSEDDANKIKEQLEEVGATVT
LK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatgtagatggcatcattgcacaacttaaagatgcttccattttggaacta
aacgacttagttaagtcgatcgaagatgaattcggtgttaaagcagctgctcctgttgct
gctggcggcgctgctggtggcgatgctgctgctaccaaggatacctatgacgttgaattg
accgaagctggccaagaaaaggttaaggttatcaaggcagttcgtgaaatcactggccaa
ggtctgaaggatgctaagggtctcgttgatgccgctcctaaggttatcaaggaaggcttg
tccgaagacgacgctaacaagatcaaggaacagcttgaagaagtcggcgcaaccgtaact
ttgaaataa

DBGET integrated database retrieval system