KEGG   Lactobacillus rhamnosus GG: LGG_02568Help
Entry
LGG_02568         CDS       T00987                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh00900  Terpenoid backbone biosynthesis
lrh01100  Metabolic pathways
lrh01110  Biosynthesis of secondary metabolites
lrh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LGG_02568 (ispE)
Enzymes [BR:lrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LGG_02568 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CAR88463
Position
complement(2632703..2633581)
Genome map
AA seq 292 aa AA seqDB search
MELIEKAPAKINLSLDALYRHADGEHEWQMVMTSVDLADYVSIKPSHSIQVSTDSGFLPE
DPRNLAYKAALALQRHANIRQGARIHIEKHIPVAAGLGGGSSDAAAVLRGLNSLLQLGYS
RSQLARIGLQVDSDVPYCVYSETALVTGRGDVVTPLGSLPNFWVVLAKPRVSVSTPSILN
AIDYQAGLLHPNTPEVVSGIQNHDFAQMISGMGNSLEAITASRYPEMTALKQRLKKYGAE
IAQMSGSGPTVFGLCQKHSRAMRVYNSMKGFCREVYLLRPFCLSTNSHRLRG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaactgatcgagaaagcgccggccaagattaatctaagtttggatgctttgtatcgt
catgctgacggcgaacatgagtggcagatggtgatgacatcagttgatttggctgattac
gtgagcattaagcctagccatagcattcaggtttccacagatagcggttttttacctgaa
gatccgcgaaatctggcctataaagcggcattggcgctccaacgccatgccaatatccgc
caaggtgcgcggattcatattgaaaaacacattcccgtcgctgcaggtttgggcggtggt
tcgagtgatgcagctgccgttttgcggggcttaaattcactattgcagttaggttatagt
cgctcgcagctggctcgcatcggcttacaggttgatagcgatgtgccttactgcgtttac
tcggagacggccttggttaccggacgcggcgatgtggtcacgccattgggaagtttaccg
aacttttgggttgttttggctaagccgcgggtgtcagtgtcaacgccaagtattcttaat
gcaattgactatcaggccggccttttgcacccaaatacacctgaagtcgtttccgggatt
caaaaccatgatttcgcccaaatgattagcggaatggggaatagtttagaggccattacg
gcaagtcgttatcctgaaatgaccgcattgaaacagcggctaaaaaagtacggcgctgaa
atcgctcaaatgtcaggtagcggtccaacggtgtttggtctttgtcagaagcattctcgg
gcaatgcgggtttacaacagtatgaagggattttgtcgtgaggtttatctgttgcggcca
ttttgcctgtcaacgaatagtcatcggctgaggggttga

DBGET integrated database retrieval system