KEGG   Lactobacillus rhamnosus GG: LGG_02672Help
Entry
LGG_02672         CDS       T00987                                 

Gene name
bglA
Definition
beta-glucosidase (GH1)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lrh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2731396..2732850)
Genome map
AA seq 484 aa AA seqDB search
MIKQRRGERRGVIIQFNADFVWGAATSGPQAEGTFHKKHENIFDYHYHTRPQDFHHNVGP
DVASNFYNDYIADLKLLKRAGVQALRISIQWTRLIDDLEEATVDQAGADYYRRVFAEMHD
LGITPYVNLHHFDLPVVLQHQYGGWQSKHVVELYAKFAARCFELFSDQVTHWFTFNEPKV
IVDGQYLYQFHYPNIVDGKAAVQVAYNLNLASAKAIAVFRKLNRNPKGTIGTIINLTPVY
PASQADNDRAAAHFAELWANDLYMEPAIHGYFPEELVDRLERDGVLWDATPDELDIISAN
RIDVLGVNYYHPFRVQAPAIDPESLQPWLPDIYFDHYELPGRKMNLDKGWEIYPAALYDI
AMNIKDRYDNIPWFVAENGIGVADETRFLKDGVIQDDYRIRFMTEHLQFLNRAIAKGANC
HGYFSWTGIDCWSWLNAYKNRYGLIRNDLRTQTKSLKKSGYWFQKVSSTGHVPELAMQSG
NKGR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgattaagcagagacgcggagaaagaaggggagttatcatccaatttaatgctgatttt
gtctggggagcagctacaagtggtccgcaggcagaaggaacttttcataaaaaacatgaa
aacatttttgactatcattaccatacccgccctcaggattttcatcataatgttggaccg
gatgtagcatcgaatttttataacgattatattgctgacctgaaactgttaaaacgtgct
ggtgttcaggcattacggatttctattcagtggacaagattgattgacgacttggaagag
gcgactgtggatcaggcaggtgcggattactatcggcgtgtgtttgcagaaatgcatgat
cttggcatcacaccgtatgttaatttacatcatttcgatttaccggttgtgctacagcac
caatatggcggttggcaatccaaacatgttgttgaactttatgcaaaatttgctgcacgc
tgttttgaactctttagtgatcaagtcacgcactggtttacattcaatgagcctaaagta
atcgttgatggccaatatttatatcaatttcactatccaaatattgttgatggaaaggcg
gcagtacaggtggcctataatctgaacctagctagtgctaaggccattgctgtatttaga
aagcttaatcgtaatcctaagggcaccattggcaccattattaatttgacgcctgtttat
cctgcgtcacaagcagataatgatcgggcagctgcccactttgccgagttgtgggccaat
gatctttatatggagccagcgattcatggttattttcctgaagaacttgttgaccgactt
gagcgggatggtgttttatgggatgcaacaccagatgaactagatatcatttcggctaac
cgcattgatgtacttggcgtcaattattaccatccttttcgcgttcaagcgccagcaatt
gatcctgagagcctgcagccatggttgcctgatatttattttgatcattacgaattgcca
ggtagaaagatgaacttggataaggggtgggagatttatcctgctgcactgtacgatatt
gcgatgaatataaaagatcgctatgacaatataccttggtttgtggcggaaaacggcatt
ggtgtggcagatgaaactcgtttcttgaaagatggcgtcatacaagacgactaccgtatt
cgatttatgactgagcaccttcaattcttgaatcgggcaattgcaaaaggcgctaattgt
cacggttacttttcgtggaccggcattgattgttggtcgtggctaaatgcatataaaaat
cgttacggtctgatccgcaatgatttgcgcacccaaaccaaatcacttaaaaaatcgggt
tactggtttcaaaaagtttcgtcaaccgggcacgtgcccgagcttgcaatgcagtcgggc
aacaaaggtagatag

DBGET integrated database retrieval system