KEGG   Lactobacillus rhamnosus Lc 705: LC705_00049Help
Entry
LC705_00049       CDS       T00990                                 

Gene name
srfJ
Definition
O-Glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LC705_00049 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LC705_00049 (srfJ)
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     LC705_00049 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(56307..57884)
Genome map
AA seq 525 aa AA seqDB search
MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPGDAAKIVIDPADRHQEWIGAGAA
ITDAAASLIWKQSKEQRSALLHEMFDPEEGHFSTIRIPLGSCEPASQPYYTYDDVPFGEH
DASLSKFSVGEGEPGAPDATKDLKYLIPVVQEILAINPAVKIMASPWSAPAWMKSTGELK
MGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLEEYRKYGIPIYAITIQNEPSNAAAWPA
MIWKIPELAHFGYKFLRPALDKTFPDTKIYFWDGSLNVLDVIDKPLSELVTPDEAAAFDG
FAFHTYDGPYTNLFKGSRLNPNWKLAMTERRCMIEETPEDASHIMFGLIGNWLVRQGLNM
IDLWNIALDERGLPNQVGSTGRRGVVTIDHTTGKVQRNLEYYMLRNFNQDVVPGSIVIGS
TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNPSGKPLDAAVTINNDGPVTWQHVTVPAWGT
VTLHKAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaactgaaaaaggcttatacccgacggaattttggacggtaacggctggcgat
ctggcacaaaagcgtgaccatctggcaactccaaaaccagaaacgacacccggcgatgca
gccaagatcgtgattgatcctgctgaccggcatcaggaatggatcggcgcaggtgccgcc
atcaccgatgcagcagcatcacttatctggaagcagagcaaggaacaacgcagtgccttg
ctacatgaaatgtttgacccagaagaaggtcatttctcgaccatccgtattccattagga
tcctgcgaaccagccagtcaaccttattacacttatgatgatgtgccatttggcgagcat
gatgcatccttatctaagttttctgttggtgaaggtgaacccggagcgcctgatgcaacc
aaagatcttaaatatctgattccggttgttcaggaaattctggcgattaacccagccgtt
aagattatggcttcaccatggtctgctcccgcttggatgaagagtaccggcgaactaaaa
atgggcggccacttacgttttggcgaatataccaacaatggctatgcaattaaggacacg
ttcgaaggcgtttacgcgcaatactttgttcgttaccttgaagaatatcgcaagtatggc
attccgatttacgccatcacgatccaaaacgaaccttccaatgcagctgcatggccagcc
atgatctggaagattccggaactggcacactttggctacaagttccttcgcccggctttg
gacaagaccttccctgataccaagatttacttctgggatggcagtttaaacgtccttgat
gtcatcgacaagccactaagcgagttggtgacccctgatgaagcggctgcatttgatggt
tttgccttccatacctacgatggtccttacaccaacttgtttaaaggcagtcgcctgaat
ccaaactggaaactcgccatgaccgaacgccgctgcatgatcgaagaaacaccagaagat
gcttctcatattatgtttggcttgatcggtaattggctcgtgcgtcaaggcttgaacatg
attgatctttggaacattgccttggacgaacggggcttgccaaaccaggtagggtcaact
ggccgtcgcggggttgtcaccattgatcacacaaccggtaaagttcaacgtaacctggaa
tactacatgctgcgtaacttcaaccaagatgttgttccgggatctattgtgattggctcc
accaactacacgcaagatggctacaccggtggcttaggctccgttgcctttcttgctccc
gatggcgccattgctgctcacctctacaacccatccggcaagccgttggacgccgccgtt
accatcaacaatgacggcccggttacttggcagcatgttaccgttccggcatggggaacc
gtaacgcttcataaggcatttggtcccgtcaatgaaagtgcgccgcgtcaggatgaagac
ttcaagctgaatccttatccggcaaatctgatggacgactgggcaccgggcaaaggtgtg
aatgctaacaagaaataa

DBGET integrated database retrieval system