KEGG   Lactobacillus rhamnosus Lc 705: LC705_00085Help
Entry
LC705_00085       CDS       T00990                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC705_00085 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC705_00085 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LC705_00085 (trpA)
Enzymes [BR:lrl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LC705_00085 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95327..96136)
Genome map
AA seq 269 aa AA seqDB search
MSNLAAIFKNHKAFIPFVVADDPDLDTTVKNIVALAHGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFEIVEAARKKTAVPIVFLTYLNIVFKYGYDTFLKRCAELKVSGL
VIPDLPYESRAEIVPFAEKYGIDIIPLITPTSGHRIEKIAKSASGFIYVVSSVGITGERD
EFFTGLKTLVTEIKRYTDVPTAIGFGIHTPQQAQTMASIADGVIIGSAIVDIVAKEAQNA
PAAIEQFTKAIRAAVDTQKQTESVVSRNA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttagctgccatcttcaaaaatcataaagctttcatcccttttgtcgttgcg
gacgacccggacttggataccactgtcaaaaacattgttgcccttgcacatggcggcgcg
gatattgtcgaattgggtatccccttttctgacccggttgcggatgggccagtgattcag
gctgcggacctgcgcgcatttgctgccaacgtgcgcaccaaaaccgtttttgaaatcgtt
gaagcagcgcggaagaaaaccgcagtgccgatcgtgtttctgacttacttaaacatcgtc
tttaagtacggctacgatacctttttgaagcgttgcgccgagctaaaggttagcggtctg
gtgatccccgatctgccatacgaaagtcgcgctgaaattgtgccgtttgcagaaaagtat
ggcattgatattatcccgttaatcacaccgacttctggccaccggatcgaaaaaattgcc
aaaagtgcttctggtttcatctacgtggtttcctctgtgggcatcaccggtgaacgggac
gaatttttcaccggtctaaaaacgttggttacggaaatcaaacgctacactgatgtgcca
acagcaatcggcttcggtatccataccccgcaacaagcccaaaccatggcgtcgattgcg
gatggcgtcattatcggcagcgccatcgtggacattgtcgccaaggaagcgcaaaacgcc
cccgctgcgattgagcagtttacaaaggcgattcgggcagcggttgatacgcaaaagcaa
accgagtctgtcgttagtaggaatgcttaa

DBGET integrated database retrieval system