KEGG   Lactobacillus rhamnosus Lc 705: LC705_00086Help
Entry
LC705_00086       CDS       T00990                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC705_00086 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC705_00086 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LC705_00086 (trpB)
Enzymes [BR:lrl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LC705_00086 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96129..97349)
Genome map
AA seq 406 aa AA seqDB search
MKTLNETAQPTNRAGRYGNDFGGQYIPETLMTELEKITAAFNTLKDDPQFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKIRLIAET
GAGQHGVATATIAALMGMECEIFMGKEDTDRQKLNVYRMTLLGAKVHSVTSGSMVLKDAV
NAALQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISIESKQQLQAKAGQLPDMIVAC
VGGGSNAIGSFAAYIDEPSVQLVGVEAAGKGVDTARTAATIERGSVGIFHGMKSLFMQNE
DGQIDPVYSISAGLDYPGVGPEHAALAEAGRAQYVGITDDEAVQAFEYIARQEGIVAAIE
SCHAIAYVEKIAPTMAKDQIIICTLSGRGDKDVASIAKYKGVDVDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactaaatgaaactgctcaacctacaaaccgcgccggccgctatggcaacgac
tttggcggccagtatatcccggaaaccttaatgaccgaactcgaaaaaatcaccgcggct
ttcaacactttaaaagacgacccgcaattcaaagccgaactcaacgatttgttagtcaat
tatgctaaccgaccatcgctactgtattacgccaaaaacatgaccgaagacttaggcggg
gccaagatctatctcaaacgtgaggatctcaatcatactggtgcccataaaatcaacaat
gttatcggacaagccttactcgccaagcatctaggcaaaatccggttaattgccgaaacc
ggcgctggccaacacggtgttgccaccgcaacgattgccgctttgatgggcatggaatgt
gaaattttcatgggaaaagaagacactgaccgccaaaagttaaatgtttatcgcatgacc
ttgctcggcgccaaagtccattctgtcaccagcggctcgatggtgcttaaagacgcggtc
aacgctgcccttcaggaatgggccagtcgcagcgatgacaccttttatgtgcttggttca
gccgtgggtccagcaccatttccggagatggtcaaacattttcaaagcgtcatttccatt
gaatccaagcaacaactgcaggctaaagcaggacagctgccggacatgatcgtagcctgt
gtcggcggcggcagtaacgccattggcagttttgccgcatacattgatgagccttctgta
caactggtcggcgttgaagccgctggcaaaggtgttgatacggcgcgaaccgctgctacg
atcgaacgcggcagtgtcggtattttccacggcatgaaatccttattcatgcaaaacgaa
gatggacaaatcgatccggtttactccatctctgctggtcttgactaccccggcgttggc
ccggaacacgccgccctcgccgaagcaggccgtgcccaatatgttgggatcaccgatgac
gaagcagttcaggcatttgaatacatcgcgagacaagaaggcattgtcgcggcgatcgaa
agctgccacgccattgcttacgttgaaaaaattgccccaaccatggccaaggaccaaatc
atcatctgcaccttatccggccgcggcgataaagatgttgctagcattgccaaatacaaa
ggagttgacgttgatgagtaa

DBGET integrated database retrieval system