KEGG   Lactobacillus rhamnosus Lc 705: LC705_00088Help
Entry
LC705_00088       CDS       T00990                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC705_00088 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LC705_00088 (trpC)
Enzymes [BR:lrl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LC705_00088 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97936..98715)
Genome map
AA seq 259 aa AA seqDB search
MILDDLVAATKIRLARHQQRQSLTELKRIVAHQPPTTKSDFLTILKQPGLHVIAEVKKAS
PSKGTIVADFPYMAIAQAYEQAGVDAISVLTEPDYFNGHLRYLKTISQQVSVPTLRKDFT
IDPYMIYEAKANGASIILLIVAILTDQQLRTFRQLAENLGMQAIVEAYTAEEVTRALQSG
VKIIGTNNRNLKNFQVDFTNSLKLRAMVPDSIPVIAESGIQTQQDVEKLAAAGFNAVLIG
ETLMRSKHKRELITAFRGI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagatgatctcgtggcagcaaccaaaatccgccttgctcgccaccaacaacgc
caatccttaactgaactcaaacgcatcgttgcccatcaaccacccaccacaaaatcagac
ttcctcaccatcttaaagcagcctggtttacacgttatcgccgaggtcaaaaaagcttcg
ccatcaaaaggaacgatcgtggcggattttccttatatggcgattgctcaagcttacgaa
caagccggcgtcgatgctatttccgtcctcactgaacctgattacttcaacggccatctt
cgctatttaaagacgatcagccaacaagtctcagtgcccacactgcgtaaagattttacg
attgatccctatatgatttacgaagccaaggcaaatggtgcgtccattattttactcatt
gttgccatcttaactgatcaacaattacgcaccttccgccaactcgcggagaatctcggc
atgcaagccattgttgaagcctacaccgccgaagaagtgacccgtgctttgcaatcaggc
gtaaaaatcatcggcactaacaaccggaatttgaaaaattttcaggttgattttacaaac
agtctgaaactacgcgccatggttcctgactcgattcctgttatcgccgaaagcgggatc
caaacgcaacaagatgtcgaaaagttagctgcagccggtttcaacgccgtcttaatcggt
gaaaccctcatgcgctccaagcacaagcgggaattaattacggcattcagggggatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system