KEGG   Lactobacillus rhamnosus Lc 705: LC705_00194Help
Entry
LC705_00194       CDS       T00990                                 

Gene name
xfp
Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LC705_00194 (xfp)
Enzymes [BR:lrl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LC705_00194 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
204916..207297
Genome map
AA seq 793 aa AA seqDB search
MDTKVKTVDYSSKEYFDKMTAYWRAANYVSVGQLYLKDNPLLERPLKSEDVKPHPIGHWG
TIAGQNFIYTHLNRVINKYDLNMFYIEGPGHGGQVMVSNSYLDGSYSEIYPRVSQDKEGM
KNLFTQFSWPGGVASHASAQTPGSIHEGGELGYALSHATGAILDNPDVIAAVVTGDGETE
TGPLAASWFSNTFINPISDGAILPIVHMNGFKISNPTILSRKSDEDLTKYFEGMGWKPYF
VEGDDPTKLNPEMAKVMDAAIEEIKAIQKHARETGDTTMPHWPVIIFRSPKGWTGPKSWN
GEPIEGSFRAHQIPIPVDAEDMEHADSLAGWLKSYHPEELFDENGKLIPELAALPPKGDK
RMAANPITNGGLDPKPLVLPDYRKYALDNKEHGKQIKQDMIVWSDYLRDLIKLNPHNFRI
FGPDETMSNRLYSLFEVTNRQWLEPIKEPADQYLAPAGRIIDSQLSEHQSEGFNEGYTLT
GRHGLFTSYEAFLRVVDSMLTQHFKWIRKAHEEPWHKAYPSLNVVSTSTSFQQDHNGYTH
QDPGILTHMAEKKAEYIREYLPADANSLLAISPKLFSSQNTVNVLITSKQPRPQFYSIDE
ATVLANAGLKRIDWASNDDGVEPDVVIAAAGTEPNMESLAAINLLHDAFPDLKIRFINVL
DLLKLRSPEIDPRGLSDAEFNSYFTTDKPILFAYHGFEGLIRDIFFTRQNRNVLIHGYRE
EGDITTPFDMRVLNELDRFHLAKDVIQHVPAYAEKAAAFVQKMDDTLQYHHDFIRANGED
IPEVQEWTWKSIK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaagtaaagaccgttgattactcatccaaggaatactttgacaagatgact
gcttattggcgggcagctaactatgtgtcagttgggcagctttatttgaaggacaatcct
ttactggaacgaccactgaaaagtgaagatgtgaagccacatccgatcggccactgggga
acgattgctgggcaaaacttcatttatacgcacttgaatcgggttattaataagtacgat
ctcaatatgttctatattgaaggtccgggtcatggtggccaggtcatggtttccaactcc
tacctcgatggttcgtattcagagatttatccacgggtttcccaggataaagaagggatg
aagaacctgttcacccaattttcctggccgggtggtgtggcatcgcatgcgagtgcccag
acaccaggctcaattcatgaaggtggggagctaggttatgcgctgagccatgcaaccggg
gcgattttggataatcctgatgtgattgccgcggttgtcaccggtgatggcgaaacggaa
acaggtccgttagccgcatcttggtttagcaataccttcattaatccaatcagtgacggg
gcaattttaccgatcgtgcatatgaacggcttcaagatttctaacccaacgattctgtca
cggaaatcagatgaagatctgaccaagtactttgaaggcatgggttggaagccatacttt
gttgaaggcgatgacccaaccaagcttaatcctgaaatggcgaaagttatggacgctgcg
atcgaagaaatcaaagcgattcaaaaacatgcccgtgaaaccggcgataccacgatgcca
cattggccagtgattattttccgctcaccaaagggatggacgggtcctaagagctggaat
ggcgaaccaatcgaaggctcgttccgcgcgcatcagattccgatcccggttgatgctgaa
gatatggaacatgccgattcactggctggctggctgaagtcgtaccatccagaagaattg
tttgatgaaaatggcaagctgattccggagctggccgcgttaccgccaaagggtgacaaa
cgaatggccgctaacccgatcaccaatggcgggcttgatccgaagccactggtattgcct
gattatcgcaagtatgcactggataacaaagaacatggtaagcaaattaagcaggatatg
attgtgtggtcagattatctgcgtgatttgatcaagttgaacccgcataacttccggatc
tttggccctgatgaaaccatgagtaaccggctttacagtctgtttgaagtcaccaatcgc
cagtggctggaaccaattaaggaaccggctgaccagtacttggcaccggctggccggatt
attgattcccagttgtcagaacatcaatcagaaggctttaatgaaggctatacgctgact
ggccggcatggcttgttcaccagctatgaagcatttctgcgcgtggttgattcgatgctc
acccagcacttcaagtggattcgcaaggctcatgaggaaccatggcacaaggcttatccg
agcctgaacgtggtttcaacttcgacgtccttccagcaggatcacaacggctacacccat
caggatccaggcattttgactcacatggcggaaaagaaagccgaatacatccgcgaatat
ctgccagctgatgcgaatagtttattggccatttcaccaaaactgttcagctcacaaaac
acggttaatgtgctgatcacttccaagcagccgcggccacagttttacagtattgatgaa
gcaactgttttggccaatgctggcttgaaacggattgattgggcttccaatgatgatggt
gttgagccggatgttgtcattgctgctgccgggaccgagccaaatatggaaagtcttgct
gcgattaacttgctgcatgacgctttcccagacttgaagattcgcttcattaacgtgctt
gatcttttgaaactgcgcagtccagaaatcgatccgcgtgggttgagtgatgctgaattc
aacagttacttcacgacggataagccgattctctttgcttatcatggttttgaaggcttg
atccgtgacatcttctttacccgtcagaatcgtaacgtcctgattcacggttatcgtgaa
gaaggcgatatcacgacaccatttgatatgcgggttctaaacgaacttgatcggttccac
ttggccaaggatgtcattcagcatgtaccggcatatgctgaaaaagcggctgcctttgtt
cagaagatggatgatacgttgcaatatcaccacgacttcattcgggcaaacggcgaagat
attcctgaagttcaggagtggacttggaaatcaattaagtaa

DBGET integrated database retrieval system