KEGG   Lactobacillus rhamnosus Lc 705: LC705_00248Help
Entry
LC705_00248       CDS       T00990                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LC705_00248 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LC705_00248 (murE)
Enzymes [BR:lrl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LC705_00248 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247326..248879
Genome map
AA seq 517 aa AA seqDB search
MALSLRACILLLKEHHLLKSAAIQTTEDVDMTGIAYDSRKVSGPTLFFCKGDKFRPIYLS
MAKDNGARTYVAEKPYVEGNGLNALIVRNITKAMAILSAAFFDYPQDDLFVIAYTGTKGK
TTAAYFTEAILNEARPRHIALFSTIDTVVGPEPDQRFKSNLTTPESLDLFRDMREAVENG
MTHLVMEVSSQAYLRNRVFGLTYDVGFFLNITPDHIGPNEHPTFANYLHNKLQLLVNARK
VVINAETEHFDQVYAAATTTTYPESIYLFASAGFKPKRDDIDIDFRFDSQEADVAESRFT
LVPVTEKAAALNIGGHYSLALIGDFNESNATAAIIGAGLAGVDASAAVPGIAKVKIPGRM
EHFQVPGHGTVYVDYAHNYASMKALLSFLKRSYKDPRLLVVVGSPGDKGVSRRPGFAKVL
TELATEAFLTTDDPGYEDPANIINEIDLKIDHTKVKVHKVLDRKEAITEAIKASGPKDVV
VVAGKGADPYQKIRGVNTPWPTDMAVVKEVTQSLQEG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcactatcacttagagcttgtattttattattgaaggaacatcacttattaaaaagt
gcggcaattcagaccactgaagatgtcgatatgaccggcattgcctatgattcacgaaaa
gtttccgggccgactttgtttttctgcaaaggggacaaatttcggccgatttatctgtcc
atggccaaagataacggcgccagaacctatgttgccgaaaagccttacgtggaaggtaat
ggtttaaatgccttaatcgttcggaatatcacaaaagcaatggcgattctcagtgcggcc
tttttcgattatccgcaagatgatttgtttgtaattgcttataccggtactaagggcaaa
acaaccgccgcttatttcaccgaggcgattttgaatgaggctcggccgcggcacatcgcc
ttgttctccaccattgatacagtggttggccctgagccggatcagcggtttaaatcgaac
ttaaccaccccggaaagtttggacttgttccgggatatgcgcgaagcagttgaaaatggt
atgacgcatttggtgatggaagtttccagtcaggcttatttacgtaatcgcgtctttggg
ctgacttatgatgtaggcttcttcttaaacattacccccgatcacatcggaccaaacgaa
catccgacttttgccaattatctgcacaataagctgcagttgttggtcaatgcgcgcaaa
gtagtgattaacgcggaaaccgagcattttgatcaggtctatgcggcagcaaccaccacg
acttatccggagagcatttatttgttcgccagcgctggattcaagcctaagcgcgacgac
attgatattgatttccgatttgacagccaagaagctgatgtcgccgaaagtcgctttaca
ctcgtgccggtaacggaaaaagcagcggcacttaatattggcggtcattattcgctggct
ttaatcggcgacttcaatgaaagtaatgcgacagcagcgattatcggcgccggcctggca
ggtgtggatgcatctgctgcggtgcctggcatcgccaaagtcaaaattccgggacggatg
gaacattttcaggttccgggccacggtacggtttatgtggattatgcccacaattatgct
agtatgaaggctttgttatcgttcctaaaacgttcctacaaagatccgcgcttgctggtc
gttgtcggctcccctggtgataaaggggtttcgcggcgcccgggctttgccaaagtatta
actgagttggcaacagaagcctttttaacaacagatgatcccggctatgaggatccagcc
aatattatcaatgaaatcgaccttaagattgatcacaccaaagttaaggttcacaaggtg
cttgatcgtaaagaagcgatcacggaagcgattaaggccagtggtcccaaagatgttgtg
gttgttgccggtaaaggcgcagatccgtatcaaaaaattcggggcgtcaacacaccttgg
ccgactgatatggccgttgtcaaggaagtcacccaatcgttacaggaaggctga

DBGET integrated database retrieval system