KEGG   Lactobacillus rhamnosus Lc 705: LC705_00368Help
Entry
LC705_00368       CDS       T00990                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LC705_00368 (rbsK)
Enzymes [BR:lrl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LC705_00368 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371306..372247
Genome map
AA seq 313 aa AA seqDB search
MPNHVVVIGSINVDAILHIQRLPQPGETIQMDAFSKAAGGKGANQAVAAARSGAKTSFIG
RVGNDANAAFMRGELVKNQIDTQYVATTADTETGQAYILLQASGQNSIIIQHGANFELTP
ADVQRATGLIQSADFVVAELETPVAATAEAFKIAKAADKVTILNPAPAQKDLPEALLKNV
DLIAPNETESELITGIPVTDEASMRQSAAYYHQLGIRGVVITLGSKGSFISLNGQATLVP
AFKVKAVDTTAAGDTFIGALVSNLQPDLGNIVDAATYASMASSFTVQKLGAFPSIPMGDE
VRAGLAKVKMGPA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcatgttgtcgttattggcagtatcaatgtggatgctatcttgcacattcaa
cgactgccacagccgggggaaacaattcaaatggatgctttttctaaagctgccggtggt
aagggggccaatcaagcggttgcggcggcgcgatctggcgctaagaccagtttcatcggg
cgcgtcgggaatgatgccaacgctgctttcatgcgcggcgaattggtgaaaaatcaaatt
gatacccaatatgttgcaaccaccgcagacacggaaaccggacaggcatatattctgctc
caagcatcgggccaaaactcgatcatcattcaacatggcgccaactttgaactgacgcca
gcggatgtgcagcgggcgactggcttgattcaatcggctgactttgtggttgctgaactg
gaaacgccggtagccgccacagccgaagcattcaaaatcgccaaagctgcggataaagta
accatcttaaaccccgcaccggcgcaaaaagatctgccagaagcgctgctgaaaaatgtt
gatctaatcgcacctaacgagactgaaagcgaattgatcaccggcattccggttaccgat
gaagccagcatgcgccagtccgccgcgtattatcatcaactcggcatccgcggggtggtc
atcaccctcggctcgaaaggttctttcatttcgctaaatggtcaggcaaccctcgtcccg
gccttcaaggtcaaagccgtagataccacggcagcaggggatacctttatcggtgcttta
gtcagcaaccttcagcccgatctcggcaatattgtcgatgccgcaacttacgccagcatg
gccagctcgtttactgtccagaagctcggcgcattcccgtcgattccgatgggggatgag
gtgcgtgcggggttggcaaaggttaaaatgggtcctgcgtaa

DBGET integrated database retrieval system