KEGG   Lactobacillus rhamnosus Lc 705: LC705_00425Help
Entry
LC705_00425       CDS       T00990                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lrl00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(429305..430051)
Genome map
AA seq 248 aa AA seqDB search
MFEHEREDLAKVVKIVMERDDTNIAGGNISFKVSAEDTGKEYIIMTPTMMSEAYLGDLAP
EQILVVEPHTRKIIAGEGNLTREINMHEAVYDANPDIKCVFHSHAKNAMFWATSGLNMPN
ITEATQKVGFIETLPFEPNCSEPLAELVSANIAKIGEKAIPHMYLLNSHGVLITTGGKDM
DGLTALHSALAIVDTVEWNADIAFKQTLMQKLGLLDGYYSKGNKIGSLEDLEDGTPIYNR
KAVAVNGD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacatgaacgcgaagatcttgccaaagttgtaaaaatcgtgatggaacgcgat
gatacaaatattgcaggcggaaatatttcttttaaagtgagtgcggaagataccggaaaa
gaatatatcatcatgacgccgacaatgatgtccgaggcatatttgggcgatctggctcca
gaacaaatcttggttgttgaacctcacacccgtaagattatagctggcgaaggaaatttg
acccgcgaaattaatatgcatgaagcggtttatgacgcaaatcccgacatcaaatgcgtt
ttccattcacacgctaagaatgctatgttttgggcaaccagtggcctgaacatgccgaat
atcaccgaagcaactcaaaaggtaggctttattgaaacccttccattcgaaccgaactgt
tcagaaccattagcggaactggtctccgctaacattgccaagattggtgagaaagcaatc
ccgcatatgtatcttttgaatagccacggtgtgctcattaccactggtggcaaagatatg
gatggattgaccgcacttcattctgcacttgcaattgtagatacagttgaatggaatgcc
gatatcgcctttaaacaaaccctaatgcaaaagttaggtcttttagacggttactactct
aagggaaacaagattggctcattggaagatttagaagacggaacacccatttacaaccgt
aaagcagtggcagttaacggtgactag

DBGET integrated database retrieval system