KEGG   Lactobacillus rhamnosus Lc 705: LC705_00446Help
Entry
LC705_00446       CDS       T00990                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lrl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450116..451600
Genome map
AA seq 494 aa AA seqDB search
MNVFPKDFLWGGALAACQAEGAYLQEGSGMAVSDISFFDPKLDREDLSKHRHVTTQNIEV
AMADPGTTRYPKRHGIDFYHRYREDIALCAEMGFKVFRFSIKWSRVFPTGEEAEPNPEAL
AFYDRVLTEIEHHGMTPLVTISHFEMPLALVNRYNGWADRRVIDLFYRYADSLFEHFGQR
VPYWISFNEINAGRFSTFKSTGVVEDKSDNYLQACYQAVHHQFVAAAKITKRLHEVNPKA
QMGCMIARFTTYAATSKPEDVLQMMHDDQYDNFFYTDVMVRGAYPGYMGRFFREHHVEIV
WGDEDETLLKQYPADYLAFSYYVSNVSSAAPDDLDVTDSNLKQTLKNPYLESSAWGWQID
PKGLRYTLNNLYDRYQIPLFIVENGLGAEDSVSEDGQIIDTYRIDYLQRHIEQMKEAIID
GVDLIGYTTWSSLDVVSSGTSEMSKRYGFIYVDLDDEGQGTLKRIRKASFYWYRQVIASN
GEDLAFREAAALKR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatttccaaaggactttttatggggcggcgcactagctgcctgtcaagctgaa
ggcgcttatttgcaggaaggtagcggcatggctgtttctgatatttctttctttgaccct
aagttggatcgtgaggatttatcgaagcatcgacatgtgaccacccagaatatcgaagtt
gcgatggctgatcctggaacaacacgctatcctaagcgacatggcattgatttttaccat
cgttatcgcgaggatattgcattgtgtgctgaaatgggatttaaggtgtttcgcttttcc
attaagtggagtcgtgtctttccaactggtgaagaggcggagccgaatcctgaagcgttg
gctttttatgatcgagttttgactgaaatcgaacatcatgggatgacgccgctggtcacg
atttcacactttgagatgccgttggcgttagtcaatcggtataatggctgggccgatcgc
cgggttattgatcttttttatcggtatgcggacagcttgtttgaacatttcgggcaacgg
gtgccttattggatctcattcaacgagattaatgcaggtcgtttttcaacttttaaatcg
acaggtgtcgttgaagataagagcgacaactacttgcaagcctgctatcaggcggttcac
catcaatttgttgcagccgcgaaaattaccaaacggttgcatgaagtgaatcctaaagct
caaatgggatgtatgattgcccgctttacaacgtatgcggccaccagcaagcccgaagat
gttttgcaaatgatgcatgatgatcaatatgataacttcttttatacagatgtcatggta
agaggtgcttatcctggttatatggggcggtttttccgggagcatcatgttgaaattgtt
tggggcgatgaagacgagacgctgctaaaacaatatccggctgactatttagccttcagt
tattatgtgtcgaatgtttcaagcgccgcaccagatgatcttgatgtgaccgattctaat
ctaaaacagactttgaagaatccatatctggaaagctcggcgtggggatggcaaatcgat
cccaagggtttaagatacacactgaataatttgtatgatcgctatcaaataccgcttttc
attgtcgagaacggcctcggcgccgaggattccgtgtctgaagatgggcaaatcatcgac
acttatcgaattgactatcttcaacggcacattgaacagatgaaggaagccattattgat
ggcgttgatctcattggctatacaacttggtcgtcgcttgatgttgtatcctcaggaact
tctgaaatgtcaaaacgctatggctttatctatgtggatttagatgatgagggtcagggc
acgcttaaacgtattcgtaaagcgtcgttttattggtatcgacaagtcattgcgtctaat
ggcgaagatttggcttttcgggaagcagcggcgcttaaacgttag

DBGET integrated database retrieval system