KEGG   Lactobacillus rhamnosus Lc 705: LC705_00619Help
Entry
LC705_00619       CDS       T00990                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lrl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(630482..631999)
Genome map
AA seq 505 aa AA seqDB search
MTNEQQYILAIDEGTTSTRTIIIDHNGQKVADAQREFPQYFPHPGWVEHNANEIWNAALS
TIATAFIESHIQPRQIVGIGITNQRETTVVWDKQTGLPIYNAIVWQSRQTSDIADQLKAD
GYADLVHDATGLLIDSYFSATKIRWILDHVPGAQERAENGELLFGTIDTWLSWKLSGGAI
HVTDYTNASRTMLFNIHKLDWDDEILRILNIPKQMLPEVRSNSEIYGDAAAYHFFGSTVP
IAGMVGDQQAALFGQLAIEPGMVKNTYGTGAFIVMNTGDKPTLSNHNLLTTIGYGLNGKI
TYALEGSVFVAGSAIQWLRDAMKLIERSSDSEAAARASKSQNEVYVVPAFTGLGAPYWDS
DARGAIFGITRGTTREDFIKATLQSLAYQSRDVVDTMNKDTGMPIPALRVDGGAANNDYL
MQFQADILGIPIERAANLETTAMGAAFFAGLATGFWNSTDELQSIVKVGKRFEPTMDVSD
RESLYEGWKQAVAATQQYKHTSKQD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacgaacagcagtatattctggcgattgatgaaggaacaaccagcacgcgtacc
atcatcatcgatcacaatgggcaaaaagttgctgatgcccagcgcgaatttccacagtat
tttccacatcctggttgggttgaacataacgcaaatgaaatctggaatgctgcgttatcc
acgattgccacagcgtttatcgaatcgcatattcagccgcgccaaattgttgggatcggc
attacgaatcagcgggaaacaacggtcgtgtgggataagcaaactgggctgcccatttac
aacgccattgtttggcaatcccgtcaaaccagcgacattgctgatcaacttaaagcggat
ggctatgctgatctagttcacgatgccaccggtttgctaattgattcctacttctctgct
accaaaattcgctggattctggatcatgtaccaggagcgcaggaacgggctgaaaatggt
gaattgctttttggcaccattgacacttggctatcatggaagctttctggcggtgccatt
catgtcaccgactacaccaatgcttcacgaaccatgctcttcaatatccacaagttggat
tgggatgatgagatcttacggattctcaacatccccaagcaaatgctgccggaagttcgc
agcaattcagaaatttatggggatgcagcagcctatcatttcttcggcagtaccgttccc
attgccggtatggtcggggatcagcaagcagcattattcggacagctggctatcgaaccg
ggaatggtcaaaaacacgtatggtaccggtgcctttatcgtcatgaataccggcgataag
ccaaccttgtcgaatcataatctgctaaccactattggctacggacttaacggcaagatc
acttatgccttggaaggttcggtctttgtggctggcagcgccattcaatggttacgtgat
gccatgaaactgattgagcgttcaagcgactccgaagctgccgcacgagcatccaagagt
caaaacgaggtctatgtcgtccctgcctttactggcttaggtgctccttactgggattcg
gatgcacgtggcgctattttcggaattacccgtggaacaactcgggaagacttcatcaag
gcaacgttacaatcgcttgcttatcaatcccgtgatgttgtcgacacgatgaacaaggat
accggcatgccgattccagctctgcgcgttgatggcggggctgctaataacgattacctc
atgcagtttcaggctgacatccttggtattccgattgaacgcgccgccaaccttgagacc
actgccatgggtgccgccttctttgccgggctagcaaccggattctggaacagcaccgat
gaactccaaagtatcgtcaaggtcggtaagcgctttgaaccgaccatggacgtatcagac
cgggaatcactttacgaaggctggaaacaagccgttgccgccacccaacagtacaagcac
acctccaagcaagactaa

DBGET integrated database retrieval system