KEGG   Lactobacillus rhamnosus Lc 705: LC705_00907Help
Entry
LC705_00907       CDS       T00990                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lrl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lrl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900888..901361
Genome map
AA seq 157 aa AA seqDB search
MSIYDFEVTLEDGSKYSLNKYKGRPMLIVNTATKCGFAPQFDGLEALYKKYQKAGLIVLG
FPSNQFKQELADGHAAAEACRMKYGVSFPMHQLIKVNGQQTAPLFKYLKTEAPGELGKSI
KWNFTKFLVDRNGHVVKRFAPKTTPEAIEPAVEELLS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttacgattttgaagtaacgctagaagacggttccaagtattcattgaataaa
tataaaggccggccgatgttgatcgtcaatacggcaaccaaatgtggttttgccccgcag
ttcgacggtttggaagcattgtataaaaagtatcaaaaagcaggcttgatcgtgttagga
tttccatcaaatcagtttaagcaagagctggcggatggacatgctgcagcagaggcatgt
cgaatgaagtacggggtcagctttccgatgcatcaactgatcaaggtcaatggtcagcag
acggcgccgttgtttaagtatttaaagaccgaggctccaggtgaattgggtaagtcgatc
aaatggaacttcaccaagtttttggtcgatcgcaacggtcatgttgtgaagcgctttgca
cctaaaacaactcctgaagcaatcgagccagcggttgaggagctgttatcctaa

DBGET integrated database retrieval system