KEGG   Lactobacillus rhamnosus Lc 705: LC705_00988Help
Entry
LC705_00988       CDS       T00990                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC705_00988 (tpiA)
   01230 Biosynthesis of amino acids
    LC705_00988 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC705_00988 (tpiA)
   00051 Fructose and mannose metabolism
    LC705_00988 (tpiA)
   00562 Inositol phosphate metabolism
    LC705_00988 (tpiA)
Enzymes [BR:lrl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LC705_00988 (tpiA)
Exosome [BR:lrl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LC705_00988 (tpiA)
  Exosomal proteins of bladder cancer cells
   LC705_00988 (tpiA)
  Exosomal proteins of melanoma cells
   LC705_00988 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
982687..983442
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQAFLDAVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMGVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
DSFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaccattcattgctggtaactggaaaatgaacaagaaccctaaggagacgcaa
gccttcttagatgctgttaaaggtaagttacctgatgcaagcaaagttgaaacagtcatt
ggcgcacctgccattgatctaacgacgctggttgccggtgcagaaggcactcctttgaag
acagcggcggaaaactgctactttgaagacgaaggtgcttttaccggcgaaaccagcccg
aaagccttaaaagaaatgggcgttgattacgtcattatcggtcacagtgaacgtcgtggt
tatttccacgaaaccgacgaagatatcaacaagaaggctaaggccatctttaagaacaat
cttttgccgattatctgctgtggtgaaagtttggctcagcgtgaagccggtcaaaccgaa
gattgggttgcttctcaaatcgaagcagctttggcaggcttaagtgccgaccaagttaag
gtttcggttttggcttacgaaccaatctgggctatcggcactggtaaaacagcaactgca
gatcaagcacaagaagttgttgctcacatccgtgcaaccgttgagaagttgtataataaa
gatacggcagatgctgttcggattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatattgatggtggcttagttggtggcgcttcgatggatcct
gacagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system