KEGG   Lactobacillus rhamnosus Lc 705: LC705_00994Help
Entry
LC705_00994       CDS       T00990                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988297..988473
Genome map
AA seq 58 aa AA seqDB search
MIFRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRAGYGVYVPLFPGMGQWSR
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgattttccgcaaaccacaaccattcgaatatgaaggtaccgatactggcgtggtattg
ttacatgcatacacgggtagccccaatgatatgaattttatggcgcgggccttgcagcga
gccggttatggggtttatgttccgctttttccgggcatgggacagtggagccgttag

DBGET integrated database retrieval system