KEGG   Lactobacillus rhamnosus Lc 705: LC705_00996Help
Entry
LC705_00996       CDS       T00990                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Brite
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LC705_00996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988706..989029
Genome map
AA seq 107 aa AA seqDB search
MNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAY
QLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQENEG
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggttagcaggcaaatcagatgaaagcacacagattctggcatatttgccggga
cagttggccgcaatcgatcagtttgccacgacggttgctgctgatttaaatttagtcaaa
cagccgacttttattggacaagccggtcaggatgaattagttgatggtcgattagcgtat
caattacgcgatgccttaatcaatgctgcacgcgttgattttcattggtatgatgatgcc
aagcatgtcattaccgttaactcggcccatcacgcattagaagaagacgtaatcgcattt
atgcaacaagaaaacgagggatag

DBGET integrated database retrieval system