KEGG   Lactobacillus rhamnosus Lc 705: LC705_01092Help
Entry
LC705_01092       CDS       T00990                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LC705_01092
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LC705_01092
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LC705_01092
Lipid biosynthesis proteins [BR:lrl01004]
 Fatty acid synthase
  Component type
   LC705_01092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1075552..1076334)
Genome map
AA seq 260 aa AA seqDB search
MKKIWLGLGVLLLLLAAGCGVSRQAAKSSRSSAPVRSRQASAASTPPRPTRLAQLKAKSK
TQLVYAPFGDSLSVGLFADKKATRFTSLFARQLARLTSKTVTEAGIAEVGKTATNLGVPA
LPQLIAQHPDVITIEFGTNDAVGGATPTALAAYQQALTTIVTTLQKETSAQLILMTTWSP
NQGPYVNADLKFDAVVKAVGQTYQVPVVDLATIWQGHDDVTGPAGTVIPDFTANGPRDTF
HPNQRGHDQIAAQLIKTLEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttggttgggattgggtgttttactattgttgctagcggctggctgtggg
gtttcgcggcaagctgctaagtcaagccgctcctctgcgccagttcgcagtcggcaggcc
agcgccgcttcaacgccgccgcgcccgacccgactggcgcaattgaaggccaaaagcaaa
acacagttagtttatgctccttttggcgacagtctttcagttggcctttttgccgataaa
aaagccactcgttttacatcgctttttgcccggcagctggcccgattaaccagcaaaacc
gtcaccgaggccggcattgcggaagtgggaaaaacggctactaacttgggcgtccccgct
ttaccgcaactcattgctcagcatccggatgtgatcactattgagtttggcaccaatgac
gctgtcggtggcgcaaccccaactgcgctcgctgcctatcaacaagcactgacaaccatt
gtcaccacgttgcaaaaagaaacctcggcacaactgatcctcatgacaacctggtcacca
aatcaagggccctacgttaatgccgacttgaaattcgatgccgttgttaaagcagtgggg
caaacctaccaggtaccggtcgttgacttggcaaccatctggcaaggtcatgatgatgtc
accggaccggctggcactgtcattccggatttcactgccaatggcccccgggatacgttc
caccctaatcaacgcggccatgatcaaattgctgctcaactcattaaaactttggaggaa
tga

DBGET integrated database retrieval system