KEGG   Lactobacillus rhamnosus Lc 705: LC705_01133Help
Entry
LC705_01133       CDS       T00990                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00040  Pentose and glucuronate interconversions
lrl00052  Galactose metabolism
lrl00500  Starch and sucrose metabolism
lrl00520  Amino sugar and nucleotide sugar metabolism
lrl01100  Metabolic pathways
lrl01130  Biosynthesis of antibiotics
Module
lrl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LC705_01133 (galU)
   00052 Galactose metabolism
    LC705_01133 (galU)
   00500 Starch and sucrose metabolism
    LC705_01133 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LC705_01133 (galU)
Enzymes [BR:lrl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LC705_01133 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAR89972
Position
1117390..1118310
Genome map
AA seq 306 aa AA seqDB search
MSVKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGK
QKRSIEDHFDSAPELEQNLKEKHKDALLQLVHSTTDIGVNLFFVRQPYPRGLGDAVRLAK
SFVGDEPFVVMLGDDLMNDKVPLTKQLIDEYDKTHASILAVKKVPHDEVSAYGVIDPEKE
VSKDLYNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILDNQKPGKGNEIQLTDAIDTL
NQTQRVFAHEFKGDRYDVGNKFGYVKTNVEYGLTHPEVKDELRAYILDLAAKLQSGKHVG
KPANKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaagttcgcaaagcagtgataccggcagccgggcttgggacccgttttctg
ccagcaaccaaagctttagctaaggaaatgttgccgattgtcgacaaaccaaccattcaa
tttatcgttgaagaagctaaggctagtgggattgaggatattctgattgttgagggtaaa
caaaaacgctctattgaagatcattttgactcagcacctgagttggaacagaatctgaaa
gaaaaacataaagacgccttgctacagctggttcattccacaaccgacatcggcgtcaac
ttattcttcgtgcggcagccatatccgcgtggtcttggtgatgccgttcgcttagccaaa
tcgtttgttggcgacgaaccattcgtggtcatgttgggtgatgacctgatgaatgacaaa
gtgccgttgaccaagcaattaattgatgaatatgataaaacccatgcgtccattcttgcc
gttaaaaaggtgccgcatgatgaagtatcggcatatggcgttattgatccggaaaaagaa
gtttccaaagacctctataacgttaagaaattcgttgaaaagcccgctgttgctgatgcc
ccaagtgacttggctatcatcggccgctacctgctgaccccggaaatctttgatattctt
gataatcaaaaaccgggcaaaggcaatgaaattcagttaaccgatgcgattgataccttg
aaccaaactcagcgcgtctttgcacatgagtttaaaggggatcgctacgatgtcggcaat
aagttcgggtacgtcaagactaatgttgaatatggcttgacccatccggaagtaaaagat
gaactccgcgcatacatccttgatctggctgctaagttgcaatcaggcaagcatgtgggg
aagccggcaaataagaagtaa

DBGET integrated database retrieval system