KEGG   Lactobacillus rhamnosus Lc 705: LC705_01133Help
Entry
LC705_01133       CDS       T00990                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LC705_01133 (galU)
   00052 Galactose metabolism
    LC705_01133 (galU)
   00500 Starch and sucrose metabolism
    LC705_01133 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LC705_01133 (galU)
Enzymes [BR:lrl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LC705_01133 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117390..1118310
Genome map
AA seq 306 aa AA seqDB search
MSVKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGK
QKRSIEDHFDSAPELEQNLKEKHKDALLQLVHSTTDIGVNLFFVRQPYPRGLGDAVRLAK
SFVGDEPFVVMLGDDLMNDKVPLTKQLIDEYDKTHASILAVKKVPHDEVSAYGVIDPEKE
VSKDLYNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILDNQKPGKGNEIQLTDAIDTL
NQTQRVFAHEFKGDRYDVGNKFGYVKTNVEYGLTHPEVKDELRAYILDLAAKLQSGKHVG
KPANKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaagttcgcaaagcagtgataccggcagccgggcttgggacccgttttctg
ccagcaaccaaagctttagctaaggaaatgttgccgattgtcgacaaaccaaccattcaa
tttatcgttgaagaagctaaggctagtgggattgaggatattctgattgttgagggtaaa
caaaaacgctctattgaagatcattttgactcagcacctgagttggaacagaatctgaaa
gaaaaacataaagacgccttgctacagctggttcattccacaaccgacatcggcgtcaac
ttattcttcgtgcggcagccatatccgcgtggtcttggtgatgccgttcgcttagccaaa
tcgtttgttggcgacgaaccattcgtggtcatgttgggtgatgacctgatgaatgacaaa
gtgccgttgaccaagcaattaattgatgaatatgataaaacccatgcgtccattcttgcc
gttaaaaaggtgccgcatgatgaagtatcggcatatggcgttattgatccggaaaaagaa
gtttccaaagacctctataacgttaagaaattcgttgaaaagcccgctgttgctgatgcc
ccaagtgacttggctatcatcggccgctacctgctgaccccggaaatctttgatattctt
gataatcaaaaaccgggcaaaggcaatgaaattcagttaaccgatgcgattgataccttg
aaccaaactcagcgcgtctttgcacatgagtttaaaggggatcgctacgatgtcggcaat
aagttcgggtacgtcaagactaatgttgaatatggcttgacccatccggaagtaaaagat
gaactccgcgcatacatccttgatctggctgctaagttgcaatcaggcaagcatgtgggg
aagccggcaaataagaagtaa

DBGET integrated database retrieval system