KEGG   Lactobacillus rhamnosus Lc 705: LC705_01139Help
Entry
LC705_01139       CDS       T00990                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC705_01139 (bglA)
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LC705_01139 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1125412..1126878)
Genome map
AA seq 488 aa AA seqDB search
MSICQFPENFLWGGATAANQLEGAYNVDGKGLATSDLLLGGTHNVPRQLTREVRPDAFYP
SHEAIDHFHRYQEDIALFAEMGFKVYRFSIAWTRIYPTGSASDGPSKEGLAFYAALIAEL
KRYNIEPLVTISHFESPIALTKAFNGWASRDMIEEYVTFAQTVIANFHNDVHYWLTFNEI
NMLTRPMGAYLAGGMYVDDTNRFISPDIDSTQMRLQALHHQFVASARVCSFAHGFDPNLK
IGCMLAYRMLYPLTSHPEDIALVQTATELNNFYCGDVQVKGRYPYFAKRYWRDHNIIMDM
EPWEEELLKRGTVDFFALSYYQSSTMATTESGETSGGNFFAGVKNPYLQRSAWGWEIDPR
GLRTALNQIYDRYQVPVMVVENGFGARDELIEQDGQKTVNDTARISYLRAHVAAMYDAIQ
DGVDLIGYTSWAPIDLISASTGEMAKRYGYIYVDKHDDGSGTLKRYRKRSFYWYQQVIRQ
NGLSESDA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttgtcaatttcccgaaaattttctctggggtggcgcaactgctgccaatcag
ctcgaaggcgcctataacgtggacggcaaagggttagcaaccagcgacttgttactgggc
ggcactcacaatgtcccccgtcaactcacccgcgaggtacgtccagacgcgttttacccc
agtcatgaagccattgatcattttcatcgttatcaagaagacattgcgctgtttgcggaa
atgggctttaaagtctaccgcttctccatcgcttggacgcggatttacccaaccggttct
gcaagcgacggcccaagcaaagaagggcttgccttttacgcggcgttgattgctgaactc
aagcgctacaacattgagccacttgtcacgatctcgcattttgaatcgccaattgcactg
acgaaggcgttcaacggctgggcgtcacgagacatgatcgaagaatatgttacatttgcg
caaactgtcattgccaactttcacaatgatgtccactactggctgacctttaatgaaatc
aatatgctaacccgaccgatgggagcctacttagctggcggcatgtatgtggacgacacc
aaccggttcatcagccctgatatcgattccacccaaatgcgcctccaagcactgcatcat
caatttgtggccagtgccagagtctgcagctttgcccatgggttcgatcccaacctgaaa
attggttgtatgctggcttatcgcatgctctatccgctgacaagccacccagaagatatt
gcccttgtccaaactgccaccgaacttaataatttttattgcggcgatgtccaagtgaaa
ggtcgctatccctattttgccaaacgttattggcgcgatcacaatatcatcatggatatg
gagccgtgggaagaagagctccttaaaagaggcaccgtggacttctttgctctgtcttat
taccagtccagcaccatggcgaccactgaaagcggcgaaaccagcggcggtaacttcttt
gctggcgtcaagaacccctacctccagcgcagtgcctggggctgggaaatcgatccccgc
gggttacgcacggcgcttaatcaaatttacgatcgctaccaagtgccggtaatggtcgtc
gaaaacggcttcggtgcgcgcgacgaattgattgaacaagatggccaaaaaaccgttaat
gacacggcacgcatcagctatcttcgtgcccatgttgccgccatgtatgatgctattcaa
gacggcgtggatctgatcggctacacctcatgggcaccgattgacctcatctccgccagc
accggtgaaatggccaaacgctacggctacatctacgtcgacaaacacgatgacggcagc
ggtactttgaagcgttatcggaaacgatcattttattggtatcaacaagtcatccggcaa
aacggcttatcagaatctgacgcataa

DBGET integrated database retrieval system