KEGG   Lactobacillus rhamnosus Lc 705: LC705_01188Help
Entry
LC705_01188       CDS       T00990                                 

Gene name
murC
Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lrl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lrl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1177087..1178439)
Genome map
AA seq 450 aa AA seqDB search
MAFSAKASLATAIGRSSYWFLHTFFKGGSSLPGKLANRLDPHVLQALGHNYDVIVVTGTN
GKTLTTSLIVKVLKQKYQEVLTNPTGSNMLQGITTAFLAQPKSGHGRGIAVLEVDEANVA
PVAAQLKPKAFVLTNIFRDQMDRYGEFYTTYQKILDGITLDPTAVVLANGDAPIFSSRKL
PNPIYYYGFTLTNEGDHKAPPNTDGVLCPVCQHILHYHALTYANLGNFFCPNCGFKRPEL
TYQVNAVTKMTPQSSEFVIDGQLCHIDIGGMYNIYNALAAFAVGRTFDVSPEQISQAFAY
DEKVFGRQEVIQLGAKKLTLILVKNPVGLNQVLSMIQTAKQPFGFAMLLNANYADGIDTS
WIWDGNFEEFVASKKAADYLVGGERYQDIALRLKVAGVPETKLTIKPDLGDVLTTLQEMP
QQQLYVLATYTAMLQLRKKLSDGGYIKGGF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggcattttcagcaaaagccagcctggcaactgccattggtcgcagcagctactggttc
ttacacacatttttcaaaggtggatcgagtctccccggaaaactcgctaaccgcctcgat
ccccatgttctgcaagcattaggccataactatgatgtgatcgtggtcaccggtacgaat
ggtaaaacgctcacaactagcttgatcgtcaaggtactcaaacaaaaatatcaggaagtc
ctaaccaatcccaccggctctaacatgttacaagggattacgaccgcttttttagcccag
cccaaaagcggtcatggtcgcgggatcgctgttttggaagtcgacgaagccaatgtcgct
cccgttgccgcgcagttgaagcctaaagcgtttgtgctgaccaatattttccgtgaccaa
atggaccgctatggtgagttttacacgacttaccaaaaaattctggatggtatcacgctt
gatcccaccgctgtcgtgcttgctaacggggatgcgccgattttcagttcgcggaagttg
cccaatccgatttattattacggctttacgttgaccaacgaaggcgatcacaaggccccg
ccgaatacggatggcgttctttgcccggtttgccagcacattttgcattatcacgctttg
acttacgctaatctaggcaacttcttttgccctaattgcggtttcaaacgaccagagttg
acttatcaagttaatgccgttaccaaaatgacgccgcaaagcagtgagtttgtcattgac
ggtcagctgtgtcacattgacattggcggcatgtataacatctacaatgcccttgccgca
tttgcagttggccgaacgtttgatgtcagccctgaacaaatcagccaagcgtttgcctac
gatgaaaaagtcttcggacgccaagaagtcattcagctcggggccaaaaagctgacattg
attttagttaaaaatcccgttggcctgaatcaggttctgagcatgattcaaaccgccaag
cagccttttgggtttgcaatgctattgaacgccaattacgcggatggtattgatacgagc
tggatttgggacggcaactttgaagaattcgttgcgagcaaaaaagccgccgactacctg
gttggcggcgagcgctatcaagatattgctctcaggctgaaagtagccggagtgccagaa
accaagcttaccattaagccagatcttggcgatgtgctcacgacgcttcaggaaatgccg
cagcagcaactctatgtcctcgcaacgtacacggcgatgctacaactacggaaaaaactc
agtgatggtggttatattaaaggcggtttttaa

DBGET integrated database retrieval system