KEGG   Lactobacillus rhamnosus Lc 705: LC705_01213Help
Entry
LC705_01213       CDS       T00990                                 

Gene name
dapE
Definition
succinyl diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC705_01213 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    LC705_01213 (dapE)
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LC705_01213 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1196122..1197246)
Genome map
AA seq 374 aa AA seqDB search
MTDPIAFLQKLIQIDSANGNELAVARVLQAELEAADIPTKLIPYKDDRVNLVAQLNHGDR
VLGFTGHEDVVSPGDENAWTYPPFSGKIVNNTMYGRGTDDMKSGLAAMTLALIHLKQSGF
AHPLRFMATVGEEFGAMGARQLTEQGYADDLAGLVVGEPTNKLLKYAHGGTVNYEIDSEG
VSVHSSRPEKGVNAIEGLVAFATREPHAFDQAPDDPDLGPFRHSITVIKGGDQVNTIPAH
AYLRGNLRPTPAANIELVVGLLEKLVDQANKATAANLTLNVLHRFLPVHSDKNGHLVTTA
NEAIAAVTGKPAELAVAFGGTDASEFIRSDNQFDVIVYGPGDNHFSHQIDEHVDLDSYTT
AIKTYEEIAKRFFA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcccattgcgtttttgcaaaaactaatccaaattgactctgcaaatggaaac
gaacttgcagtagcccgcgttttgcaagctgaactcgaagcggccgatattccgaccaaa
ttgatcccatacaaagatgatcgggtcaatttagttgcccagctcaatcacggtgaccgc
gtattaggcttcaccggccatgaagacgtggtgagtcccggcgatgagaacgcctggacc
tatccgcctttttccggaaagatcgtgaacaacaccatgtacggtcgcggcaccgatgat
atgaaaagtggtctagcagccatgaccttggcactgatccaccttaagcaaagcggcttt
gcccatccgctgcgtttcatggccacggtcggtgaagagtttggtgcaatgggagcgcgc
caactcaccgaacaaggttatgccgatgacttagccggactcgtggtaggcgaaccaacg
aacaaattgctaaaatacgcacacggcggaacggttaactacgaaattgacagcgaaggc
gtttccgtccacagctcccggccggaaaaaggcgttaacgcaattgaagggttggtggca
tttgctactcgcgaaccgcacgcctttgatcaggcccctgatgatcctgacctcggtcca
ttccgccactccattaccgtgatcaaaggcggcgatcaagtcaacaccattccggcccat
gcatacttacgcggcaacttgcgcccgactcctgcagcaaatatcgaattagtcgtcggg
ttattggaaaaattagtcgatcaggcaaataaagccaccgccgctaacttgacgttgaac
gttttacatcgttttttgccggtacactctgacaaaaacgggcatctcgtgacaaccgct
aacgaagccattgccgccgtgactggtaaaccagccgagttagcggtggcttttggcgga
accgacgcgtcagaattcatccgttccgataaccagtttgacgtgattgtctatggtccc
ggcgataatcatttcagtcatcagattgacgaacatgttgatttagatagctacacgaca
gcgattaaaacttacgaagaaattgccaaacgcttttttgcctga

DBGET integrated database retrieval system