KEGG   Lactobacillus rhamnosus Lc 705: LC705_01257Help
Entry
LC705_01257       CDS       T00990                                 

Definition
multidrug ABC transporter permease
Orthology
K01992  
ABC-2 type transport system permease protein
Organism
lrl  Lactobacillus rhamnosus Lc 705
Module
ABC-2 type transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238375..1239139)
Genome map
AA seq 254 aa AA seqDB search
MKTFFAQLAFDGKRLVVRNASFIFFSIIMPAGFYLLFTKIMVSGSAAEIKQFNLTYLGQM
IVYSVLIEAFFSIASILRRDREKGLTTFLRLSPHGTLPYYTSITFWMLMMSLLSVVVLGG
IAVGVNGVRLEITQWLGLIVVVLIGQLPLLMIGIALSHIHREEMLSLASNLLTFPMALVS
GLWWPISMLPSWLQAIGKLMPTYFVNNLLNELTSRAKVDLTNLIGIAVWVLLAGLVVVAM
TRNEQRRGVALGEA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattctttgcacaattagcttttgacggcaagcgattagtcgtccgaaacgcc
tcattcattttcttttcaatcatcatgccagctggattttatttacttttcactaagatc
atggtgagtggatcagctgcagaaatcaagcaattcaatctcacttacctgggccagatg
atcgtctacagtgttttaattgaggctttcttcagcattgcttctatcttaagacgtgac
cgtgaaaaaggactgacaacttttttgcggctttctccgcatggcactttaccttattac
acgtccatcactttttggatgttgatgatgagtttgctgtcagttgtggtgctaggcggg
attgcagttggggttaatggcgttcggctcgaaatcacccaatggttggggctgatagtt
gtggtcttaattggccagctgcctttgctcatgatcggaattgcgttgtcgcatatccat
cgagaagaaatgctcagtcttgccagtaacttgctgactttcccgatggcccttgtcagt
ggcttatggtggcccatcagcatgttgccaagttggcttcaagcgattggcaagctgatg
ccgacttatttcgtcaacaatctcttaaatgaactgacgtcacgtgctaaagtagactta
accaatttgattggcatagctgtttgggtcttacttgccggcttggtcgttgtggcaatg
actcgaaacgaacaacggagaggcgtggcattgggtgaggcatag

DBGET integrated database retrieval system