KEGG   Lactobacillus rhamnosus Lc 705: LC705_01257Help
Entry
LC705_01257       CDS       T00990                                 

Definition
(GenBank) ABC transporter, multidrug transporter permease component
  KO
K01992  
ABC-2 type transport system permease protein
Organism
lrl  Lactobacillus rhamnosus Lc 705
Module
ABC-2 type transport system
Brite
Transporters [BR:lrl02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    LC705_01257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1238375..1239139)
Genome map
AA seq 254 aa AA seqDB search
MKTFFAQLAFDGKRLVVRNASFIFFSIIMPAGFYLLFTKIMVSGSAAEIKQFNLTYLGQM
IVYSVLIEAFFSIASILRRDREKGLTTFLRLSPHGTLPYYTSITFWMLMMSLLSVVVLGG
IAVGVNGVRLEITQWLGLIVVVLIGQLPLLMIGIALSHIHREEMLSLASNLLTFPMALVS
GLWWPISMLPSWLQAIGKLMPTYFVNNLLNELTSRAKVDLTNLIGIAVWVLLAGLVVVAM
TRNEQRRGVALGEA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattctttgcacaattagcttttgacggcaagcgattagtcgtccgaaacgcc
tcattcattttcttttcaatcatcatgccagctggattttatttacttttcactaagatc
atggtgagtggatcagctgcagaaatcaagcaattcaatctcacttacctgggccagatg
atcgtctacagtgttttaattgaggctttcttcagcattgcttctatcttaagacgtgac
cgtgaaaaaggactgacaacttttttgcggctttctccgcatggcactttaccttattac
acgtccatcactttttggatgttgatgatgagtttgctgtcagttgtggtgctaggcggg
attgcagttggggttaatggcgttcggctcgaaatcacccaatggttggggctgatagtt
gtggtcttaattggccagctgcctttgctcatgatcggaattgcgttgtcgcatatccat
cgagaagaaatgctcagtcttgccagtaacttgctgactttcccgatggcccttgtcagt
ggcttatggtggcccatcagcatgttgccaagttggcttcaagcgattggcaagctgatg
ccgacttatttcgtcaacaatctcttaaatgaactgacgtcacgtgctaaagtagactta
accaatttgattggcatagctgtttgggtcttacttgccggcttggtcgttgtggcaatg
actcgaaacgaacaacggagaggcgtggcattgggtgaggcatag

DBGET integrated database retrieval system