KEGG   Lactobacillus rhamnosus Lc 705: LC705_01325Help
Entry
LC705_01325       CDS       T00990                                 

Gene name
recD
Definition
helicase, RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lrl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313856..1316321
Genome map
AA seq 821 aa AA seqDB search
MDRHEDSVTGRVKSIFFQNPTNFFKILLIDITATTITWTEPDIVVTGTFGDIKEDETYTF
TGHVVDHPKYGQQFQADNYHVDRPTNKTGLINYLSSDKFPGIGPKTAEKIIDKLGVDAID
RILDDPESLKGLGISAAKQKMLVTNLKTNQGMERVIIGLNDYGFTSNMAGRIYQQYQNDA
LEVIKQNPYQLINDIDGIGFTRADQIAAKLAIAADSQLRLGGAVMDTLQRLTDGEGDTFV
DLKTLVTQTLDLLERARQVAVNPEAVGQAIVTLAKDNALVAEGKRIFPKRLYDSEWQIAR
QLKGLADAGRAAKQPALAEIKQTLAAVQEETGIAYDEVQKKAIITALQSPIFLLTGGPGT
GKTTVTDGIVRTYAQLHDLSLDRHEYTPDDPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNDLPDGLLIIDEMSMVDTYLFRTLLTALHPGMQIVLVGDKDQLPSVG
PGQVFADLLRSQALPHAALTHIHRQDADSSIIPLAHAVNAGRLPDDFTRPQVDRSFLPCS
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQDILNPKRSARTKTV
HFGETEYRIGDKILQLVNDPNQNVFNGEIGQIVGITLAKEAASKTDELTIDFDGNEITYK
RSDFSKITLAYATSIHKAQGSEFPMVILPLTMQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFETAVGEIAVNRHTGLVQRLQQAFGMTVSQPDVEKPTPATEVSKNNGQIDTNPSDLDN
GISTDESNNYQLTPALVASQRIDPMIGMNGVTPQMFMTKEK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcatgaagatagcgtcactggccgggtcaaaagtattttctttcagaatccg
actaacttttttaaaatcctgctgattgatatcacggcaaccacgattacctggacggag
ccggatattgtggtgaccggtacgttcggggatattaaagaagatgagacgtacacgttt
accgggcatgtcgtggaccatccgaaatatggccagcagtttcaagcggataattaccat
gtggatcggcctacgaataaaacgggactgatcaattatcttagttccgacaagtttccg
ggaattggccccaaaacagcggagaaaatcattgacaagctcggggttgatgcgattgat
cgtattttggatgaccctgagagcttaaaaggattggggatttcggcggccaagcagaag
atgctggtcaccaatctcaagacgaatcagggaatggaacgggtcatcatcggtcttaat
gactacggcttcaccagtaacatggctggccgaatttatcagcaatatcaaaatgatgcg
ctggaagtcattaagcaaaatccgtatcagttaatcaatgatattgacggtatcgggttt
acgcgggccgatcagattgccgccaagttagcgattgccgcggattcgcaactgcggctc
ggtggtgcggtcatggataccttgcagcgcttgacggacggtgaaggcgacacttttgtc
gatttgaaaacgttggtcacccagacgcttgatttactggagcgagcgcgtcaggttgca
gtgaaccccgaagcagtcggccaggcaatcgtcactttagccaaggacaatgcgctggta
gcggaaggtaagcgcatttttcctaaacgactttatgattccgaatggcagattgcccgg
cagttaaaaggactggcggatgccgggcgcgctgccaagcaacctgcactggccgaaatt
aaacaaacattggccgccgtacaggaagagactggcattgcctatgatgaggtgcaaaaa
aaggcgattatcactgccttgcagtcgccgatttttcttttaaccggcggccccggaacc
ggaaagacaacggtgacggacgggattgtccgcacctatgcgcaattgcatgatttatcc
ttggatcgccatgaatacacgccggatgatcctttcccgattatgctagcagcaccgact
ggccgggctgctaaacggatcagtgagacgacacagttaccggcaagcacgattcatcga
ctattgggattgggcgtggatacgcaggagtttgcgcctaatgatctcccggacggcctt
ttaattattgatgaaatgtcgatggttgatacgtatctttttcgaacgttgttgacggcg
ctgcacccgggtatgcaaattgtgttggttggcgataaagatcagctgccaagtgtcgga
ccgggacaggtttttgctgatttgttacgcagccaggctttacctcacgcagcgttaacc
cacattcaccgccaggacgcggacagttcgattatcccgttggcgcatgcagtcaatgcc
gggcgcttgccggatgacttcacccgcccgcaagtggatcggagctttttgccgtgttca
cccagccaggttccggaagtggtcgggcaggtggttcagcgtgccgcggttaaacagttt
tcgattgcggacattcaggtgcttgcaccaatgtatcgcggaactgcggggattgatcgg
ttgaatccattgttgcaggatattttgaacccgaaacgcagcgctcggacaaaaaccgtt
cattttggcgaaaccgagtatcgaattggcgataaaattctgcaattggtcaacgatccg
aatcaaaatgtgtttaatggcgaaattggccagattgtcgggatcacacttgccaaagag
gcggccagtaaaaccgatgagttgacgattgattttgacggcaatgaaataacgtataaa
cgcagcgacttcagcaaaatcaccttggcttatgcgacttcgattcacaaagcgcaaggc
agcgagtttccaatggtgattttgccattaaccatgcagagtcgccggatgctgcgccgg
aacctactttatacggccattacccgagcaaaatcgtttttgattctggtgggcgagctg
gctgcatttgagaccgcagttggcgaaattgcggtaaatcggcatacgggtttggtccag
cggctgcaacaagcgtttggcatgaccgtttcccagccggacgtagaaaagccgacgcct
gcaactgaagtcagcaagaataacggacaaattgacactaacccgtctgacttggataat
ggaattagtactgacgaatcgaacaattatcagctaacccctgcattggtggcttcacag
cggattgatcctatgattgggatgaatggtgtgacgccacaaatgtttatgacgaaggag
aaataa

DBGET integrated database retrieval system