KEGG   Lactobacillus rhamnosus Lc 705: LC705_01336Help
Entry
LC705_01336       CDS       T00990                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC705_01336 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC705_01336 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LC705_01336 (pdhC)
   00620 Pyruvate metabolism
    LC705_01336 (pdhC)
Enzymes [BR:lrl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LC705_01336 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1326342..1327982
Genome map
AA seq 546 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAQPAAAPAAATDASAGNAPVAKSVYQFKLPELGEGLA
EGEIVKWAVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETATVGEALVD
IDAPGHNDTPVASGTAAAPQANTDTAASAAAPAAAGSVPAITDPNREILAMPSVRQYARE
QGIDISQVPATGKHGRITKADIDAFKAGAPAAAPAQPAATSAPKAAQPAPAATPAAPKPQ
PVAPYVSTGSEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDEVEVSKLMAHRKKYK
QYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIATNTDHGLY
VPVIKNADAKSMFEIAKEISDNAQKAYDSKLKPDEMRGGSMTISNVGSIGGGWFTPVINQ
PEVAILGVGKIAKEPYVNADNEIVVGNLLKLSLSYDHRLIDGALAQTALNLMDKLLADPD
LLLMEG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgagatcgtc
aagtgggacgtgaagccaggcgatgacatcaaggaggatgacaccctgcttgaagttcaa
agtgataaaagtgtcgaggaaattccttcaccggtttcaggaaaaattttgaagatttta
gtaccagaaggtgaaaccgcttcagtcggtgatttactggttgaaattgatgatggctcc
ggtccggccgcacaacctgcagccgcacctgccgcggcaaccgatgcttcagcaggcaat
gcgccagttgctaagtcggtctatcaatttaaattgccagaacttggtgaaggtctggcg
gaaggtgaaattgtcaagtgggcggttaaacccggtgaccagatcaaagaagacgataca
ctgcttgaggttcaaagcgataaaagcgttgaagagattccatcaccagttgccggaacc
gttgttaaaattttagtaccagaaggcgaaaccgcaactgttggcgaagcgctggttgat
attgacgcaccggggcataatgatacgccggttgcatcgggtaccgctgcagcgccccaa
gccaatacggatacggctgcctcggccgcggcaccagctgctgccggatcagtaccggcc
atcaccgatccaaatcgggaaattctggcgatgccgtctgttcgccaatatgcacgcgaa
caaggcattgatatttcacaagtgccagcaactgggaagcatgggcgcattaccaaagcc
gatatcgatgcctttaaagcaggggcaccagctgcagcacctgcgcagccagcagcaacc
tccgcgcctaaagcagcgcaaccagctccagcagcaacaccggcagcgccaaaaccgcag
ccagtcgcgccttacgtttcaaccggcagtgaagccgagctggagactcgcgagaagatg
acgccaacgcgcaaggcaattgccaaggcaatgttagcttcgaaacaacgaagcccgcat
gtcacgagctttgacgaggttgaagtgtccaagttaatggcgcatcggaagaagtacaag
cagtacgcggctgataaaggcattaaattaacgttcttgccatacatcgttaaagctttg
gtcacggtattgcgtgaatatccagaatttaatgcgtcaattgacgacaccaccgatgag
attgtttacaaacattactttaatatcgggattgccacgaacacggatcatgggttatac
gtgccggtcatcaagaatgctgatgccaagagcatgttcgaaattgccaaggaaatcagt
gacaatgcacaaaaggcatatgacagcaagttgaagccagatgagatgcgcggcggttcc
atgaccattagtaacgttggttcaattggtggtggctggttcacaccggtgatcaatcag
ccggaagttgccatccttggtgtcggtaaaattgctaaagagccatatgtcaacgctgat
aatgaaattgttgtcggtaacctgttgaagttgagcttgagttatgatcatcgcttgatt
gatggtgctttggcgcaaaccgcattgaatctcatggataaattgttagcagaccctgat
ctgctgttgatggagggataa

DBGET integrated database retrieval system