KEGG   Lactobacillus rhamnosus Lc 705: LC705_01336Help
Entry
LC705_01336       CDS       T00990                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase complex E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00010  Glycolysis / Gluconeogenesis
lrl00020  Citrate cycle (TCA cycle)
lrl00620  Pyruvate metabolism
lrl01100  Metabolic pathways
lrl01110  Biosynthesis of secondary metabolites
lrl01120  Microbial metabolism in diverse environments
lrl01130  Biosynthesis of antibiotics
lrl01200  Carbon metabolism
Module
lrl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC705_01336 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LC705_01336 (pdhC)
   00620 Pyruvate metabolism
    LC705_01336 (pdhC)
Enzymes [BR:lrl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LC705_01336 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N DUF2118 DUF1780
Motif
Other DBs
NCBI-ProteinID: CAR90175
Position
1326342..1327982
Genome map
AA seq 546 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAQPAAAPAAATDASAGNAPVAKSVYQFKLPELGEGLA
EGEIVKWAVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETATVGEALVD
IDAPGHNDTPVASGTAAAPQANTDTAASAAAPAAAGSVPAITDPNREILAMPSVRQYARE
QGIDISQVPATGKHGRITKADIDAFKAGAPAAAPAQPAATSAPKAAQPAPAATPAAPKPQ
PVAPYVSTGSEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDEVEVSKLMAHRKKYK
QYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIATNTDHGLY
VPVIKNADAKSMFEIAKEISDNAQKAYDSKLKPDEMRGGSMTISNVGSIGGGWFTPVINQ
PEVAILGVGKIAKEPYVNADNEIVVGNLLKLSLSYDHRLIDGALAQTALNLMDKLLADPD
LLLMEG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgagatcgtc
aagtgggacgtgaagccaggcgatgacatcaaggaggatgacaccctgcttgaagttcaa
agtgataaaagtgtcgaggaaattccttcaccggtttcaggaaaaattttgaagatttta
gtaccagaaggtgaaaccgcttcagtcggtgatttactggttgaaattgatgatggctcc
ggtccggccgcacaacctgcagccgcacctgccgcggcaaccgatgcttcagcaggcaat
gcgccagttgctaagtcggtctatcaatttaaattgccagaacttggtgaaggtctggcg
gaaggtgaaattgtcaagtgggcggttaaacccggtgaccagatcaaagaagacgataca
ctgcttgaggttcaaagcgataaaagcgttgaagagattccatcaccagttgccggaacc
gttgttaaaattttagtaccagaaggcgaaaccgcaactgttggcgaagcgctggttgat
attgacgcaccggggcataatgatacgccggttgcatcgggtaccgctgcagcgccccaa
gccaatacggatacggctgcctcggccgcggcaccagctgctgccggatcagtaccggcc
atcaccgatccaaatcgggaaattctggcgatgccgtctgttcgccaatatgcacgcgaa
caaggcattgatatttcacaagtgccagcaactgggaagcatgggcgcattaccaaagcc
gatatcgatgcctttaaagcaggggcaccagctgcagcacctgcgcagccagcagcaacc
tccgcgcctaaagcagcgcaaccagctccagcagcaacaccggcagcgccaaaaccgcag
ccagtcgcgccttacgtttcaaccggcagtgaagccgagctggagactcgcgagaagatg
acgccaacgcgcaaggcaattgccaaggcaatgttagcttcgaaacaacgaagcccgcat
gtcacgagctttgacgaggttgaagtgtccaagttaatggcgcatcggaagaagtacaag
cagtacgcggctgataaaggcattaaattaacgttcttgccatacatcgttaaagctttg
gtcacggtattgcgtgaatatccagaatttaatgcgtcaattgacgacaccaccgatgag
attgtttacaaacattactttaatatcgggattgccacgaacacggatcatgggttatac
gtgccggtcatcaagaatgctgatgccaagagcatgttcgaaattgccaaggaaatcagt
gacaatgcacaaaaggcatatgacagcaagttgaagccagatgagatgcgcggcggttcc
atgaccattagtaacgttggttcaattggtggtggctggttcacaccggtgatcaatcag
ccggaagttgccatccttggtgtcggtaaaattgctaaagagccatatgtcaacgctgat
aatgaaattgttgtcggtaacctgttgaagttgagcttgagttatgatcatcgcttgatt
gatggtgctttggcgcaaaccgcattgaatctcatggataaattgttagcagaccctgat
ctgctgttgatggagggataa

DBGET integrated database retrieval system