KEGG   Lactobacillus rhamnosus Lc 705: LC705_01414Help
Entry
LC705_01414       CDS       T00990                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LC705_01414 (folA)
   00670 One carbon pool by folate
    LC705_01414 (folA)
Enzymes [BR:lrl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LC705_01414 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1408629..1409120
Genome map
AA seq 163 aa AA seqDB search
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatttttatgggcacaggatcgcgatggcttaattggcaaagatggtcatttg
ccatggcatttaccggatgatttacattatttccgggcgcagacagttggtaagatcatg
gtcgttggtcggcgcacctatgaaagttttcctaaacgtcctttacctgagcgaaccaat
gttgttttgacccatcaggaagactatcaagcgcaaggtgccgtggtcgtgcatgatgtt
gcggcggtttttgcttatgctaagcagcatcccgatcaggaactggtcattgctggcggt
gcacagatctttacggcgtttaaagatgatgtcgatacgttactggtaacacgtttggct
ggcagttttgaaggcgatacgaaaatgattccattaaactgggatgattttaccaaagtc
tccagccgcaccgttgaagataccaatccggcgctgacgcacacttatgaggtttggcaa
aagaaggcttaa

DBGET integrated database retrieval system