KEGG   Lactobacillus rhamnosus Lc 705: LC705_01414Help
Entry
LC705_01414       CDS       T00990                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lrl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lrl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1408629..1409120
Genome map
AA seq 163 aa AA seqDB search
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatttttatgggcacaggatcgcgatggcttaattggcaaagatggtcatttg
ccatggcatttaccggatgatttacattatttccgggcgcagacagttggtaagatcatg
gtcgttggtcggcgcacctatgaaagttttcctaaacgtcctttacctgagcgaaccaat
gttgttttgacccatcaggaagactatcaagcgcaaggtgccgtggtcgtgcatgatgtt
gcggcggtttttgcttatgctaagcagcatcccgatcaggaactggtcattgctggcggt
gcacagatctttacggcgtttaaagatgatgtcgatacgttactggtaacacgtttggct
ggcagttttgaaggcgatacgaaaatgattccattaaactgggatgattttaccaaagtc
tccagccgcaccgttgaagataccaatccggcgctgacgcacacttatgaggtttggcaa
aagaaggcttaa

DBGET integrated database retrieval system