KEGG   Lactobacillus rhamnosus Lc 705: LC705_02027Help
Entry
LC705_02027       CDS       T00990                                 

Gene name
glgB
Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lrl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2049761..2051824)
Genome map
AA seq 687 aa AA seqDB search
MIQGLKDWLYLFNSGQDFQSYNRFGAHEVSPGKWSFLVWAPHAQQIKVVGDFNDWRGSPL
TRQGETGCWYGELAAKKGQLYKYQVVSPDGATHEKIDPYGFGFERKPGSAARLVDIPRIK
WHDGSWLSKRSKWRPYDEPLAIYEVHLGSFIRDTHAGPDGGYMTYQDAIDKLIPYVKELG
YTHIEFLPLMEHPLDASWGYQLMGYFAPTSRFGDPADFLRLVDAAHVAGLGIIMDWVPGH
FIKNTDMLAQFDGTPTFEYTDPHRAENVRWGTWNFDLGKAQVQSFLISSAMYWLDHCHLD
GLRVDAVSNMLYMDYDAGKENDRNRFGGRDNLEGIAFLKQLNTKVFAKHPDVLMMAEESS
AYPKVSAPINTGGLGFNYKWNMGWMNDTLKFFEEDPVYRHSDMNLLTFSFMYMYNEQFVL
PFSHDEVVHGKKSLMHKMPGDRYNQFANLRTMYVWQMTFPGKKLLFMGSEWGQFLEWRDW
SELEWVDLKDPMNHKMQTFTKTLNHIYTNRPSLWQQDHEPLGTKITMADEPDVMSYIRYG
KQKDDFTVVALNFVPVQKDHFRVPVPSLGTYTILLNTENLDFGGTWTKWQATLTARLGDH
YGEPAWLDVILPAMGALLIVPKKLQPLPKKLATEHHQRPAALSGKQPPLAISNQERPAIS
HQRDWGTAPARTQPVKKDLIVKKHKKK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaggattaaaagattggttatacctcttcaactcagggcaggattttcaaagt
tacaatcggtttggtgcccatgaagtttcacctggcaaatggtcgtttctcgtctgggcg
ccacatgcacaacagattaaagttgtcggcgattttaacgattggcgcggcagtccgctg
acccggcaaggagaaaccggctgttggtacggcgaactcgcagccaagaaaggacagttg
tataagtaccaggtggtcagtccggatggggccacacatgaaaagattgatccatatggg
tttggatttgaacgtaagccaggcagcgctgcccgactggttgatattccgcgaatcaaa
tggcatgacggttcgtggctaagcaagcgtagtaagtggcgaccgtatgatgaacccttg
gcaatttatgaagtacacttaggttcttttatccgcgatacacatgccggtccggatggc
gggtatatgacctatcaggatgcgattgataagctgattccttacgtcaaggaactgggt
tatacccatattgagtttctgccgttgatggagcacccgcttgacgcttcatggggctat
cagctgatgggctactttgccccgacaagccggtttggcgacccggcagattttctgaga
ttggtggatgccgctcacgtcgccgggctgggcatcatcatggattgggtgccagggcat
ttcattaagaataccgatatgctcgctcaattcgatggtaccccgacgtttgaatacacc
gatccgcaccgcgccgaaaatgttcgctggggaacctggaattttgatttaggcaaagca
caagtgcaaagctttctgatttccagcgcgatgtactggcttgatcattgtcatcttgat
gggctgcgcgttgatgcggtctcgaatatgctgtacatggattatgacgccggcaaagaa
aatgatcgcaatcggtttggcggccgcgataatcttgagggcattgcctttttgaagcag
ctgaatacgaaggtgtttgccaagcatccggatgtcttgatgatggccgaggaaagttca
gcctatcctaaggtgtccgcgccgattaataccggtggcctagggttcaattacaaatgg
aacatgggctggatgaacgatacgctgaagttctttgaagaagatccggtttatcgccac
agtgatatgaatttattgacgttttcatttatgtatatgtataacgaacaattcgttttg
ccattttcccacgatgaagtcgttcacgggaagaagagcctgatgcacaagatgccgggc
gatcggtacaaccagtttgccaatctacgcaccatgtacgtgtggcaaatgacgtttccg
gggaaaaagctattattcatgggcagtgagtggggtcaattccttgaatggcgtgactgg
agcgagcttgagtgggttgatttgaaagacccgatgaaccataaaatgcaaacttttacg
aaaacgctgaatcatatctatacaaaccgaccgagtctgtggcaacaggatcatgaacca
cttggcactaagatcacaatggcggatgaaccggatgtcatgagttacatccgttatggc
aagcaaaaagatgacttcacggtggtcgcgttaaattttgtcccggtgcaaaaagaccac
ttccgcgtgccagtcccaagcttgggcacgtacacgattcttttgaatacggaaaacctt
gactttggcggtacctggaccaaatggcaggcgactttaaccgcccgactaggtgatcat
tacggcgagccggcttggttagatgtgattttgccagcaatgggcgcgttactaattgtt
cccaaaaaactgcagccgttgcctaaaaagttggcgactgagcaccaccagcggccagcc
gcactttccggaaagcagccgccactggcaatttcaaatcaggaacgaccggccatcagt
catcaacgcgactgggggacggcgcctgcccgaacgcaaccggtgaaaaaagacctgatt
gttaagaagcataagaagaagtga

DBGET integrated database retrieval system